RegulonDB RegulonDB 10.6.3: Gene Form
   

hha gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

maa tomB hha hhap6 hhap6 TSS_615 (cluster) TSS_615 (cluster) TSS_614 TSS_614 TSS_613 TSS_613

Gene      
Name: hha    Texpresso search in the literature
Synonym(s): ECK0454, EG10439, b0460
Genome position(nucleotides): 480090 <-- 480308 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.64
External database links:  
ASAP:
ABE-0001594
CGSC:
31084
ECHOBASE:
EB0434
ECOCYC:
EG10439
ECOLIHUB:
hha
OU-MICROARRAY:
b0460
REGULONDB:
b0460
STRING:
511145.b0460
M3D: hha
COLOMBOS: hha
PortEco: b0460


Product      
Name: haemolysin expression modulating protein
Synonym(s): Hha
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.628
Isoelectric point: 9.063
Motif(s):
 
Type Positions Sequence
13 -> 69 MRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWK
10 -> 10 D
22 -> 22 D
37 -> 37 D
48 -> 48 D

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.4 - global
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
biological_process GO:0010468 - regulation of gene expression
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Nieto JM., et al., 1991
[2] Nieto JM., et al., 1996
External database links:  
DIP:
DIP-9897N
ECOCYC:
EG10439-MONOMER
ECOLIWIKI:
b0460
INTERPRO:
IPR007985
INTERPRO:
IPR036666
MINT:
P0ACE3
MODBASE:
P0ACE3
PDB:
1JW2
PDB:
2MW2
PFAM:
PF05321
PRIDE:
P0ACE3
PRODB:
PRO_000022887
PROTEINMODELPORTAL:
P0ACE3
REFSEQ:
NP_414993
SMR:
P0ACE3
UNIPROT:
P0ACE3


Operon      
Name: tomB-hha         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR, BasR
Repressed by: PdhR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_613 480423 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_614 480431 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_615 (cluster) 480436 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter hhap6 480503 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Nieto JM., Carmona M., Bolland S., Jubete Y., de la Cruz F., Juarez A., 1991, The hha gene modulates haemolysin expression in Escherichia coli., Mol Microbiol 5(5):1285-93

 [2] Nieto JM., Juarez A., 1996, A new member of the Hha/YmoA class of bacterial regulators in plasmid R100 of Escherichia coli?, Mol Microbiol 19(2):407

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB