RegulonDB RegulonDB 10.8: Gene Form
   

hipB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yneO lsrK hipA hipB yneL IHF HipB HipAB HipB HipAB HipB HipAB HipB HipAB anti-terminator terminator hipBp hipBp TSS_1836 TSS_1836

Gene      
Name: hipB    Texpresso search in the literature
Synonym(s): ECK1501, EG10442, b1508
Genome position(nucleotides): 1592176 <-- 1592442 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.57
External database links:  
ASAP:
ABE-0005024
ECHOBASE:
EB0437
OU-MICROARRAY:
b1508
PortEco:
hipB
STRING:
511145.b1508
COLOMBOS: hipB


Product      
Name: antitoxin/DNA-binding transcriptional repressor HipB
Synonym(s): HipB
Sequence: Get amino acid sequence Fasta Format
Regulator Family: HTH_3
Cellular location: cytosol
Molecular weight: 10.016
Isoelectric point: 6.605
Motif(s):
 
Type Positions Sequence
88 -> 88 W
18 -> 69 KLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMT
21 -> 47 RQQNGWTQSELAKKIGIKQATISNFEN
73 -> 88 AKNASPESTEQQNLEW
17 -> 71 MKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLC

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0043565 - sequence-specific DNA binding
GO:0042803 - protein homodimerization activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
GO:0000985 - bacterial-type RNA polymerase core promoter sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Reference(s): [1] Hendricks EC., et al., 2000
[2] Li C., et al., 2013
External database links:  
DIP:
DIP-9899N
ECOCYC:
EG10442-MONOMER
ECOLIWIKI:
b1508
INTERPRO:
IPR001387
INTERPRO:
IPR010982
MODBASE:
P23873
PDB:
4YG7
PDB:
4YG4
PDB:
4YG1
PDB:
3HZI
PDB:
3DNV
PDB:
2WIU
PDB:
4Z58
PDB:
5K98
PDB:
4Z5H
PDB:
4Z5D
PDB:
4Z5C
PDB:
4Z59
PFAM:
PF01381
PRIDE:
P23873
PRODB:
PRO_000022890
PROSITE:
PS50943
REFSEQ:
NP_416025
SMART:
SM00530
SMR:
P23873
UNIPROT:
P23873


Operon      
Name: hipBA         
Operon arrangement:
Transcription unit        Promoter
hipBA


Transcriptional Regulation      
Display Regulation             
Activated by: IHF
Repressed by: HipAB, HipB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1836 1592159 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hendricks EC., Szerlong H., Hill T., Kuempel P., 2000, Cell division, guillotining of dimer chromosomes and SOS induction in resolution mutants (dif, xerC and xerD) of Escherichia coli., Mol Microbiol 36(4):973-81

 [2] Li C., Wang Y., Chen G., 2013, Interaction investigations of HipA binding to HipB dimer and HipB dimer + DNA complex: a molecular dynamics simulation study., J Mol Recognit 26(11):556-67

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB