RegulonDB RegulonDB 10.8: Gene Form
   

hisA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hisB hisF hisA hisI hisH TSS_2364 TSS_2364 TSS_2363 TSS_2363 TSS_2362 TSS_2362 TSS_2361 TSS_2361 TSS_2360 TSS_2360 TSS_2359 TSS_2359 TSS_2358 TSS_2358 TSS_2357 TSS_2357 TSS_2356 TSS_2356 TSS_2355 TSS_2355

Gene      
Name: hisA    Texpresso search in the literature
Synonym(s): ECK2019, EG10444, b2024
Genome position(nucleotides): 2095125 --> 2095862 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.18
External database links:  
ASAP:
ABE-0006725
CGSC:
636
ECHOBASE:
EB0439
OU-MICROARRAY:
b2024
PortEco:
hisA
STRING:
511145.b2024
COLOMBOS: hisA


Product      
Name: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
Synonym(s): HisA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.033
Isoelectric point: 4.711
Motif(s):
 
Type Positions Sequence
126 -> 126 L
84 -> 84 S
1 -> 234 MIIPALDLIDGTVVRLHQGDYGKQRDYGNDPLPRLQDYAAQGAEVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRSEEDVAALLEAGVARVVVGSTAVKSQDMVKGWFERFGADALVLALDVRIDEQGNKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISRDGTLAGSNVSLYEEVCARYPQVAFQSSGGIGDIDDVAALRGTGVRGVIVGRALLEGKFT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.16 - histidine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016853 - isomerase activity
GO:0003949 - 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity
biological_process GO:0000105 - histidine biosynthetic process
GO:0000162 - tryptophan biosynthetic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0008652 - cellular amino acid biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
PRIBFAICARPISOM-MONOMER
ECOLIWIKI:
b2024
INTERPRO:
IPR011060
INTERPRO:
IPR023016
INTERPRO:
IPR013785
INTERPRO:
IPR006063
INTERPRO:
IPR006062
MODBASE:
P10371
PFAM:
PF00977
PRIDE:
P10371
PRODB:
PRO_000022891
REFSEQ:
NP_416528
SMR:
P10371
UNIPROT:
P10371


Operon      
Name: hisLGDCBHAFI         
Operon arrangement:
Transcription unit        Promoter
hisL
hisLGDCBHAFI
hisBHAFI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2355 2093486 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2356 2094307 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2357 2094355 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2358 2095145 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2359 2096338 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2360 2096542 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2361 2096572 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2362 2096612 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2363 2096625 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2364 2096772 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB