RegulonDB RegulonDB 10.8: Gene Form
   

hisC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hisD hisC hisB hisG hisH TSS_2357 TSS_2357 TSS_2356 TSS_2356 TSS_2355 TSS_2355 TSS_2354 TSS_2354 TSS_2353 TSS_2353 TSS_2352 TSS_2352 hisBp hisBp TSS_2351 (cluster) TSS_2351 (cluster) TSS_2350 TSS_2350 TSS_2349 TSS_2349 TSS_2348 TSS_2348 TSS_2347 TSS_2347 TSS_2346 (cluster) TSS_2346 (cluster) TSS_2345 TSS_2345 TSS_2344 TSS_2344 TSS_2343 TSS_2343 TSS_2342 TSS_2342 TSS_2341 TSS_2341 TSS_2340 TSS_2340 TSS_2339 TSS_2339 TSS_2338 TSS_2338 TSS_2337 TSS_2337 TSS_2336 TSS_2336 TSS_2335 TSS_2335 TSS_2334 TSS_2334 TSS_2333 TSS_2333

Gene      
Name: hisC    Texpresso search in the literature
Synonym(s): ECK2016, EG10446, b2021
Genome position(nucleotides): 2092398 --> 2093468 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.37
External database links:  
ASAP:
ABE-0006717
CGSC:
634
ECHOBASE:
EB0441
OU-MICROARRAY:
b2021
PortEco:
hisC
STRING:
511145.b2021
COLOMBOS: hisC


Product      
Name: histidinol-phosphate aminotransferase
Synonym(s): HisC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.36
Isoelectric point: 4.724
Motif(s):
 
Type Positions Sequence
149 -> 149 V
46 -> 351 QLTQQTLNRYPECQPKAVIENYAQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSVSAETIGVECRTVPTLDNWQLDLQGISDKLDGVKVVYVCSPNNPTGQLINPQDFRTLLELTRGKAIVVADEAYIEFCPQASLAGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKVIAPYPLSTPVADIAAQALSPQGIVAMRERVAQIIAEREYLIAALKEIPCVEQVFDSETNYILARFKASSAVFKSLWDQGIILRDQNKQPSLSGCLRITVGTREESQRVIDAL
130 -> 130 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.16 - histidine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0008483 - transaminase activity
GO:0030170 - pyridoxal phosphate binding
GO:0004400 - histidinol-phosphate transaminase activity
GO:0042802 - identical protein binding
biological_process GO:0000105 - histidine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009058 - biosynthetic process
External database links:  
DIP:
DIP-9902N
ECOCYC:
HISTPHOSTRANS-MONOMER
ECOLIWIKI:
b2021
INTERPRO:
IPR015424
INTERPRO:
IPR015422
INTERPRO:
IPR015421
INTERPRO:
IPR005861
INTERPRO:
IPR004839
INTERPRO:
IPR001917
MINT:
MINT-1322565
MODBASE:
P06986
PDB:
1GEY
PDB:
1IJI
PDB:
1GEX
PDB:
1GEW
PDB:
1FG7
PDB:
1FG3
PFAM:
PF00155
PRIDE:
P06986
PRODB:
PRO_000022893
PROSITE:
PS00599
REFSEQ:
NP_416525
SMR:
P06986
UNIPROT:
P06986


Operon      
Name: hisLGDCBHAFI         
Operon arrangement:
Transcription unit        Promoter
hisL
hisLGDCBHAFI
hisBHAFI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2333 2090363 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2334 2090601 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2335 2090638 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2336 2090650 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2337 2090803 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2338 2090809 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2339 2090819 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2340 2091010 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2341 2091072 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2342 2091081 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2343 2091087 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2344 2091101 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2345 2091377 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2346 (cluster) 2091387 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2347 2091423 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2348 2092208 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2349 2092215 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2350 2092396 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2351 (cluster) 2093335 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2352 2093364 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2353 2093383 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2354 2093403 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2355 2093486 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2356 2094307 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2357 2094355 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB