RegulonDB RegulonDB 10.8: Gene Form
   

hisF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wzzB hisF hisA hisI hisH TSS_2364 TSS_2364 TSS_2363 TSS_2363 TSS_2362 TSS_2362 TSS_2361 TSS_2361 TSS_2360 TSS_2360 TSS_2359 TSS_2359 TSS_2358 TSS_2358

Gene      
Name: hisF    Texpresso search in the literature
Synonym(s): ECK2020, EG10448, b2025
Genome position(nucleotides): 2095844 --> 2096620 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.87
External database links:  
ASAP:
ABE-0006727
CGSC:
631
ECHOBASE:
EB0443
OU-MICROARRAY:
b2025
PortEco:
hisF
STRING:
511145.b2025
COLOMBOS: hisF


Product      
Name: imidazole glycerol phosphate synthase subunit HisF
Synonym(s): HisF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.454
Isoelectric point: 4.813
Motif(s):
 
Type Positions Sequence
46 -> 46 E
123 -> 123 Q
5 -> 239 RIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRVAEVIDIPFCVAGGIKSLEDAAKILSFGADKISINSPALADPTLITRLADRFGVQCIVVGIDTWYDAETGKYHVNQYTGDESRTRVTQWETLDWVQEVQKRGAGEIVLNMMNQDGVRNGYDLEQLKKVREVCHVPLIASGGAGTMEHFLEAFRDADVDGALAASVFHKQII
124 -> 124 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.16 - histidine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009382 - imidazoleglycerol-phosphate synthase complex
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0000107 - imidazoleglycerol-phosphate synthase activity
biological_process GO:0000105 - histidine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
CYCLASE-MONOMER
ECOLIWIKI:
b2025
INTERPRO:
IPR011060
INTERPRO:
IPR013785
INTERPRO:
IPR006062
INTERPRO:
IPR004651
MODBASE:
P60664
PFAM:
PF00977
PRIDE:
P60664
PRODB:
PRO_000022895
REFSEQ:
NP_416529
SMR:
P60664
UNIPROT:
P60664


Operon      
Name: hisLGDCBHAFI         
Operon arrangement:
Transcription unit        Promoter
hisL
hisLGDCBHAFI
hisBHAFI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2358 2095145 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2359 2096338 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2360 2096542 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2361 2096572 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2362 2096612 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2363 2096625 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2364 2096772 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB