RegulonDB RegulonDB 10.8: Gene Form
   

hisG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hisD hisG hisL hisC Cis-reg; leader terminator anti-terminator anti-anti-terminator TSS_2350 TSS_2350 TSS_2349 TSS_2349 TSS_2348 TSS_2348 TSS_2347 TSS_2347 TSS_2346 (cluster) TSS_2346 (cluster) TSS_2345 TSS_2345 TSS_2344 TSS_2344 TSS_2343 TSS_2343 TSS_2342 TSS_2342 TSS_2341 TSS_2341 TSS_2340 TSS_2340 TSS_2339 TSS_2339 TSS_2338 TSS_2338 TSS_2337 TSS_2337 TSS_2336 TSS_2336 TSS_2335 TSS_2335 TSS_2334 TSS_2334 TSS_2333 TSS_2333 TSS_2332 TSS_2332 TSS_2331 (cluster) TSS_2331 (cluster)

Gene      
Name: hisG    Texpresso search in the literature
Synonym(s): ECK2014, EG10449, b2019
Genome position(nucleotides): 2090192 --> 2091091 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.11
External database links:  
ASAP:
ABE-0006713
CGSC:
630
ECHOBASE:
EB0444
OU-MICROARRAY:
b2019
PortEco:
hisG
STRING:
511145.b2019
COLOMBOS: hisG


Product      
Name: ATP phosphoribosyltransferase
Synonym(s): HisG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.367
Isoelectric point: 5.296
Motif(s):
 
Type Positions Sequence
6 -> 6 R
223 -> 296 ARESKYIMMHAPTERLDEVIALLPGAERPTILPLAGDQQRVAMHMVSSETLFWETMEKLKALGASSILVLPIEK
54 -> 219 RDDDIPGLVMDGVVDLGIIGENVLEEELLNRRAQGEDPRYFTLRRLDFGGCRLSLATPVDEAWDGPLSLNGKRIATSYPHLLKRYLDQKGISFKSCLLNGSVEVAPRAGLADAICDLVSTGATLEANGLREVEVIYRSKACLIQRDGEMEESKQQLIDKLLTRIQG
263 -> 263 V
49 -> 50 DI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.16 - histidine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0003879 - ATP phosphoribosyltransferase activity
GO:0000287 - magnesium ion binding
GO:0042803 - protein homodimerization activity
biological_process GO:0000105 - histidine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
External database links:  
ECOCYC:
ATPPHOSRIBOSTRANS-MONOMER
ECOLIWIKI:
b2019
INTERPRO:
IPR020621
INTERPRO:
IPR015867
INTERPRO:
IPR013820
INTERPRO:
IPR013115
INTERPRO:
IPR018198
INTERPRO:
IPR001348
INTERPRO:
IPR011322
MODBASE:
P60757
PANTHER:
PTHR21403
PDB:
1Q1K
PDB:
1H3D
PFAM:
PF01634
PFAM:
PF08029
PRIDE:
P60757
PRODB:
PRO_000022896
PROSITE:
PS01316
REFSEQ:
NP_416523
SMR:
P60757
UNIPROT:
P60757


Operon      
Name: hisLGDCBHAFI         
Operon arrangement:
Transcription unit        Promoter
hisL
hisLGDCBHAFI
hisBHAFI


RNA cis-regulatory element    
Attenuation: Transcriptional
   
Cis-reg; leader Histidine operon leader
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2331 (cluster) 2089999 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2332 2090173 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2333 2090363 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2334 2090601 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2335 2090638 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2336 2090650 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2337 2090803 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2338 2090809 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2339 2090819 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2340 2091010 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2341 2091072 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2342 2091081 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2343 2091087 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2344 2091101 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2345 2091377 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2346 (cluster) 2091387 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2347 2091423 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2348 2092208 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2349 2092215 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2350 2092396 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB