RegulonDB RegulonDB 10.8: Gene Form
   

hisI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wzzB hisF hisA hisI TSS_2364 TSS_2364 TSS_2363 TSS_2363 TSS_2362 TSS_2362 TSS_2361 TSS_2361 TSS_2360 TSS_2360 TSS_2359 TSS_2359 TSS_2358 TSS_2358

Gene      
Name: hisI    Texpresso search in the literature
Synonym(s): ECK2021, EG10451, b2026, hisE, hisIE
Genome position(nucleotides): 2096614 --> 2097225 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.58
External database links:  
ASAP:
ABE-0006729
ECHOBASE:
EB0446
OU-MICROARRAY:
b2026
PortEco:
hisI
STRING:
511145.b2026
COLOMBOS: hisI


Product      
Name: putative bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
Synonym(s): HisE, HisI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.756
Isoelectric point: 5.092
Motif(s):
 
Type Positions Sequence
1 -> 114 MLTEQQRRELDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQRLWTKGETSGNFLNVVSIAPDCDNDTLLVLANPIGPTCHKGTSSCFGDTAHQWLF
203 -> 203 Q
193 -> 193 T
5 -> 5 Q
46 -> 46 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.16 - histidine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004635 - phosphoribosyl-AMP cyclohydrolase activity
GO:0004636 - phosphoribosyl-ATP diphosphatase activity
biological_process GO:0008152 - metabolic process
GO:0000105 - histidine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9907N
ECOCYC:
HISTCYCLOPRATPPHOS
ECOLIWIKI:
b2026
INTERPRO:
IPR021130
INTERPRO:
IPR008179
INTERPRO:
IPR002496
INTERPRO:
IPR023019
INTERPRO:
IPR038019
PFAM:
PF01502
PFAM:
PF01503
PRIDE:
P06989
PRODB:
PRO_000022898
PRODOM:
PD002610
REFSEQ:
NP_416530
SMR:
P06989
SWISSMODEL:
P06989
UNIPROT:
P06989


Operon      
Name: hisLGDCBHAFI         
Operon arrangement:
Transcription unit        Promoter
hisL
hisLGDCBHAFI
hisBHAFI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2358 2095145 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2359 2096338 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2360 2096542 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2361 2096572 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2362 2096612 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2363 2096625 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2364 2096772 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB