RegulonDB RegulonDB 10.8: Gene Form
   

hisS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hisS yfgM sroE hisSp hisSp TSS_2808 TSS_2808 TSS_2807 TSS_2807 TSS_2806 TSS_2806 TSS_2805 TSS_2805 TSS_2804 (cluster) TSS_2804 (cluster) TSS_2803 TSS_2803 TSS_2802 TSS_2802 TSS_2801 TSS_2801 TSS_2800 TSS_2800 yfgMp1 yfgMp1 yfgMp2 yfgMp2 TSS_2799 (cluster) TSS_2799 (cluster) yfgMp3 yfgMp3 TSS_2798 TSS_2798 TSS_2797 TSS_2797 bamBp bamBp TSS_2796 (cluster) TSS_2796 (cluster) TSS_2795 (cluster) TSS_2795 (cluster)

Gene      
Name: hisS    Texpresso search in the literature
Synonym(s): ECK2510, EG10453, b2514
Genome position(nucleotides): 2639301 <-- 2640575 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.75
External database links:  
ASAP:
ABE-0008278
CGSC:
624
ECHOBASE:
EB0448
MIM:
614504
MIM:
616625
OU-MICROARRAY:
b2514
PortEco:
hisS
STRING:
511145.b2514
COLOMBOS: hisS


Product      
Name: histidine—tRNA ligase
Synonym(s): HisRS, HisS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 47.029
Isoelectric point: 5.715
Motif(s):
 
Type Positions Sequence
339 -> 420 DTQSAAMALAERLRDELPGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLR
10 -> 312 GMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISEHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGGRATPAVGFAMGLERL
2 -> 424 AKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISEHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAERLRDELPGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.1 - amino acid -activation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016874 - ligase activity
GO:0004812 - aminoacyl-tRNA ligase activity
GO:0004821 - histidine-tRNA ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006412 - translation
GO:0006427 - histidyl-tRNA aminoacylation
Note(s): Note(s): ...[more].
Reference(s): [1] Englert M., et al., 2017
External database links:  
DIP:
DIP-35894N
ECOCYC:
HISS-MONOMER
ECOLIWIKI:
b2514
INTERPRO:
IPR004154
INTERPRO:
IPR041715
INTERPRO:
IPR036621
INTERPRO:
IPR033656
INTERPRO:
IPR015807
INTERPRO:
IPR006195
INTERPRO:
IPR004516
MINT:
MINT-1236095
MODBASE:
P60906
PANTHER:
PTHR43707
PDB:
2EL9
PDB:
1HTT
PDB:
1KMM
PDB:
1KMN
PFAM:
PF13393
PFAM:
PF03129
PRIDE:
P60906
PRODB:
PRO_000022903
PROSITE:
PS50862
REFSEQ:
NP_417009
SMR:
P60906
UNIPROT:
P60906


Operon      
Name: hisS         
Operon arrangement:
Transcription unit        Promoter
hisS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2795 (cluster) 2638676 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2796 (cluster) 2638683 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2797 2639033 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2798 2639305 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2799 (cluster) 2639374 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2800 2639941 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2801 2639974 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2802 2640203 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2803 2640283 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2804 (cluster) 2640538 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2805 2640541 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2806 2640554 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2807 2640563 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2808 2640565 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Englert M., Vargas-Rodriguez O., Reynolds NM., Wang YS., Soll D., Umehara T., 2017, A genomically modified Escherichia coli strain carrying an orthogonal E. coli histidyl-tRNA synthetase·tRNAHis pair., Biochim Biophys Acta 1861(11 Pt B):3009-3015

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB