RegulonDB RegulonDB 10.8: Gene Form
   

truA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdxB usg truA dedA anti-anti-terminator anti-terminator TSS_2626 TSS_2626 usgp usgp dedAp2 dedAp2

Gene      
Name: truA    Texpresso search in the literature
Synonym(s): ECK2312, EG10454, asuC, b2318, hisT, leuK
Genome position(nucleotides): 2434824 <-- 2435636 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.35
External database links:  
ASAP:
ABE-0007657
CGSC:
623
ECHOBASE:
EB0449
OU-MICROARRAY:
b2318
PortEco:
truA
STRING:
511145.b2318
COLOMBOS: truA


Shine dalgarno      
Sequence: gaaactggtgCAGGAGtatctgtactAAT


Product      
Name: tRNA pseudouridine38-40 synthase
Synonym(s): AsuC, HisT, LeuK, TruA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.4
Isoelectric point: 8.741
Motif(s):
 
Type Positions Sequence
151 -> 253 AAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLVAVDYP
168 -> 172 QCQSR
107 -> 111 FHARF
58 -> 58 R
17 -> 111 EYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKTVPDDFHARF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0106029 - tRNA pseudouridine synthase activity
GO:0016853 - isomerase activity
GO:0003723 - RNA binding
GO:0009982 - pseudouridine synthase activity
GO:0000049 - tRNA binding
GO:0042803 - protein homodimerization activity
biological_process GO:0009451 - RNA modification
GO:0001522 - pseudouridine synthesis
GO:0031119 - tRNA pseudouridine synthesis
GO:0008033 - tRNA processing
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11043N
ECOCYC:
EG10454-MONOMER
ECOLIWIKI:
B2318
INTERPRO:
IPR001406
INTERPRO:
IPR020095
INTERPRO:
IPR020097
INTERPRO:
IPR020103
MINT:
MINT-1310146
MODBASE:
P07649
PANTHER:
PTHR11142
PDB:
2NR0
PDB:
2NQP
PDB:
1DJ0
PDB:
2NRE
PFAM:
PF01416
PRIDE:
P07649
REFSEQ:
NP_416821
SMR:
P07649
UNIPROT:
P07649


Operon      
Name: pdxB-usg-truA-dedA         
Operon arrangement:
Transcription unit        Promoter
usg-truA-dedA
pdxB-usg-truA-dedA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter dedAp2 2434940 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2626 2437519 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB