RegulonDB RegulonDB 10.6.3: Gene Form
   

hmp gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glyA hmp glnB NsrR FNR Fur NsrR NsrR MetR MetR PurR ppGpp hmpAp hmpAp glyAp glyAp TSS_2845 (cluster) TSS_2845 (cluster) TSS_2844 (cluster) TSS_2844 (cluster) TSS_2843 TSS_2843 TSS_2842 TSS_2842 TSS_2841 TSS_2841 TSS_2840 TSS_2840 TSS_2839 TSS_2839 TSS_2838 TSS_2838 TSS_2837 TSS_2837 TSS_2836 (cluster) TSS_2836 (cluster)

Gene      
Name: hmp    Texpresso search in the literature
Synonym(s): ECK2549, EG10456, b2552, fsrB, hmpA
Genome position(nucleotides): 2685835 --> 2687025 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.48
External database links:  
ASAP:
ABE-0008396
ECHOBASE:
EB0451
ECOCYC:
EG10456
ECOLIHUB:
hmp
OU-MICROARRAY:
b2552
REGULONDB:
b2552
STRING:
511145.b2552
M3D: hmp
COLOMBOS: hmp
PortEco: b2552


Product      
Name: nitric oxide dioxygenase
Synonym(s): FsrB, Hmp, HmpA, flavohemoglobin, flavohemoprotein
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cytosol
Molecular weight: 43.868
Isoelectric point: 5.575
Motif(s):
 
Type Positions Sequence
150 -> 255 EGTRDFRIVAKTPRSALITSFELEPVDGGAVAEYRPGQYLGVWLKPEGFPHQEIRQYSLTRKPDGKGYRIAVKREEGGQVSNWLHNHANVGDVVKLVAPAGDFFMA
259 -> 396 DTPVTLISAGVGQTPMLAMLDTLAKAGHTAQVNWFHAAENGDVHAFADEVKELGQSLPRFTAHTWYRQPSEADRAKGQFDSEGLMDLSKLEGAFSDPTMQFYLCGPVGFMQFTAKQLVDLGVKQENIHYECFGPHKVL
264 -> 372 LISAGVGQTPMLAMLDTLAKAGHTAQVNWFHAAENGDVHAFADEVKELGQSLPRFTAHTWYRQPSEADRAKGQFDSEGLMDLSKLEGAFSDPTMQFYLCGPVGFMQFTA
268 -> 273 GVGQTP
389 -> 392 CFGP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0030288 - outer membrane-bounded periplasmic space
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0008941 - nitric oxide dioxygenase activity
GO:0005504 - fatty acid binding
GO:0005344 - oxygen carrier activity
GO:0019825 - oxygen binding
GO:0020037 - heme binding
GO:0032843 - hydroperoxide reductase activity
GO:0071949 - FAD binding
biological_process GO:0009636 - response to toxic substance
GO:0015671 - oxygen transport
GO:0055114 - oxidation-reduction process
GO:0051409 - response to nitrosative stress
GO:0046210 - nitric oxide catabolic process
GO:0071500 - cellular response to nitrosative stress
Note(s): Note(s): ...[more].
Reference(s): [1] Bonamore A., et al., 2001
[2] Cooper CE., et al., 1994
[3] Hao Y., et al., 2016
[4] Herrington MB., et al., 2013
[5] Liu J., et al., 1993
[6] Orii Y., et al., 1992
[7] Shepherd M., et al., 2016
[8] Shipovskov S., et al., 2015
[9] Sosna M., et al., 2013
[10] Tinajero-Trejo M., et al., 2014
[11] Vasudevan SG., et al., 1995
External database links:  
ECOCYC:
EG10456-MONOMER
ECOLIWIKI:
b2552
INTERPRO:
IPR039261
INTERPRO:
IPR023950
INTERPRO:
IPR017938
INTERPRO:
IPR000971
INTERPRO:
IPR017927
INTERPRO:
IPR008333
INTERPRO:
IPR009050
INTERPRO:
IPR012292
INTERPRO:
IPR001433
MODBASE:
P24232
PANTHER:
PTHR43396
PDB:
1GVH
PFAM:
PF00042
PFAM:
PF00175
PFAM:
PF00970
PRIDE:
P24232
PRINTS:
PR00410
PRODB:
PRO_000022907
PROSITE:
PS01033
PROSITE:
PS51384
PROTEINMODELPORTAL:
P24232
REFSEQ:
NP_417047
SMR:
P24232
UNIPROT:
P24232


Operon      
Name: hmp         
Operon arrangement:
Transcription unit        Promoter
hmp


Transcriptional Regulation      
Display Regulation             
Activated by: MetR
Repressed by: NsrR, Fur, FNR
Growth Conditions:

[1] 

C: Escherichia coli| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| MOPS| S-nitrosoglutathione 50 然; glucose| pH 7.0| 37.0 C| OD600 below 0.7

[2] 

C: Escherichia coli| metE knockout mutant| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metE knockout mutant| MOPS| S-nitrosoglutathione 50 然; glucose| pH 7.0| 37.0 C| OD600 below 0.7

[3] 

C: Escherichia coli| metE knockout mutant| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metE knockout mutant| MOPS| glucose; sodium nitroprusside 50 然| pH 7.0| 37.0 C| OD600 below 0.7

[4] 

C: Escherichia coli| MOPS| glucose; sodium nitroprusside 50 然| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| MOPS| glucose; homocysteine 1 mM; sodium nitroprusside 50 然| pH 7.0| 37.0 C| OD600 below 0.7

[5] 

C: Escherichia coli| pH 7.0| 37.0 C| stationary phase
E: Escherichia coli| rpoS knockout mutant| pH 7.0| 37.0 C| stationary phase

[6] 

C: Escherichia coli| LB medium| pH 7.0| 37.0 C| stationary phase
E: Escherichia coli| himA knockout mutant| LB medium| pH 7.0| 37.0 C| stationary phase

[7] 

C: Escherichia coli| metC knockout mutant| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metC knockout mutant| MOPS| glucose; homocysteine 1 mM| pH 7.0| 37.0 C| OD600 below 0.7

[8] 

C: Escherichia coli| MOPS| S-nitrosoglutathione 50 然; glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| MOPS| S-nitrosoglutathione 50 然; glucose; homocysteine 1 mM| pH 7.0| 37.0 C| OD600 below 0.7

[9] 

C: Escherichia coli| metC knockout mutant| MOPS| S-nitrosoglutathione 50 然; glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metC knockout mutant| MOPS| S-nitrosoglutathione 50 然; glucose; homocysteine 1 mM| pH 7.0| 37.0 C| OD600 below 0.7

[10] 

C: Escherichia coli| LB medium| pH 7.0| 37.0 C| exponential phase
E: Escherichia coli| himA knockout mutant| LB medium| pH 7.0| 37.0 C| exponential phase

[11] 

C: Escherichia coli| MOPS| S-nitrosoglutathione 50 然; glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metR knockout mutant| MOPS| S-nitrosoglutathione 50 然; glucose| pH 7.0| 37.0 C| OD600 below 0.7

[12] 

C: Escherichia coli| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metC knockout mutant| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7

[13] 

C: Escherichia coli| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metE knockout mutant| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7

[14] 

C: Escherichia coli| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metR knockout mutant| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7

[15] 

C: Escherichia coli| metC knockout mutant| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metC knockout mutant| MOPS| S-nitrosoglutathione 50 然; glucose| pH 7.0| 37.0 C| OD600 below 0.7

[16] 

C: Escherichia coli| metC knockout mutant| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metC knockout mutant| MOPS| glucose; sodium nitroprusside 50 然| pH 7.0| 37.0 C| OD600 below 0.7

[17] 

C: Escherichia coli| metC knockout mutant| MOPS| glucose; sodium nitroprusside 50 然| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metC knockout mutant| MOPS| glucose; homocysteine 1 mM; sodium nitroprusside 50 然| pH 7.0| 37.0 C| OD600 below 0.7

[18] 

C: Escherichia coli| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| MOPS| glucose; homocysteine 1 mM| pH 7.0| 37.0 C| OD600 below 0.7

[19] 

C: Escherichia coli| metE knockout mutant| MOPS| S-nitrosoglutathione 50 然; glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metE knockout mutant| MOPS| S-nitrosoglutathione 50 然; glucose; homocysteine 1 mM| pH 7.0| 37.0 C| OD600 below 0.7

[20] 

C: Escherichia coli| metE knockout mutant| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metE knockout mutant| MOPS| glucose; homocysteine 1 mM| pH 7.0| 37.0 C| OD600 below 0.7

[21] 

C: Escherichia coli| M9 minimal medium| pH 7.0| 37.0 C| stationary phase
E: Escherichia coli| relA knockout mutant; spoT knockout mutant| M9 minimal medium| pH 7.0| 37.0 C| stationary phase

[22] 

C: Escherichia coli| MOPS| glucose; sodium nitroprusside 50 然| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metR knockout mutant| MOPS| glucose; sodium nitroprusside 50 然| pH 7.0| 37.0 C| OD600 below 0.7

[23] 

C: Escherichia coli| metE knockout mutant| MOPS| glucose; sodium nitroprusside 50 然| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| metE knockout mutant| MOPS| glucose; homocysteine 1 mM; sodium nitroprusside 50 然| pH 7.0| 37.0 C| OD600 below 0.7

[24] 

C: Escherichia coli| MOPS| glucose| pH 7.0| 37.0 C| OD600 below 0.7
E: Escherichia coli| MOPS| glucose; sodium nitroprusside 50 然| pH 7.0| 37.0 C| OD600 below 0.7



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2836 (cluster) 2684844 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [12]
  promoter TSS_2837 2684848 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_2838 2684852 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_2839 2684858 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_2840 2684978 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_2841 2685334 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_2842 2685346 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_2843 2685533 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_2844 (cluster) 2685538 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [12]
  promoter TSS_2845 (cluster) 2685572 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [12]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bonamore A., Chiancone E., Boffi A., 2001, The distal heme pocket of Escherichia coli flavohemoglobin probed by infrared spectroscopy., Biochim Biophys Acta 1549(2):174-8

 [2] Cooper CE., Ioannidis N., D'mello R., Poole RK., 1994, Haem, flavin and oxygen interactions in Hmp, a flavohaemoglobin from Escherichia coli., Biochem Soc Trans 22(3):709-13

 [3] Hao Y., Updegrove TB., Livingston NN., Storz G., 2016, Protection against deleterious nitrogen compounds: role of σS-dependent small RNAs encoded adjacent to sdiA., Nucleic Acids Res 44(14):6935-48

 [4] Herrington MB., Sitaras C., 2013, The influence of CsgD on the expression of genes of folate metabolism and hmp in Escherichia coli K-12., Arch Microbiol 195(8):559-69

 [5] Liu J., Magasanik B., 1993, The glnB region of the Escherichia coli chromosome., J Bacteriol 175(22):7441-9

 [6] Orii Y., Ioannidis N., Poole RK., 1992, The oxygenated flavohaemoglobin from Escherichia coli: evidence from photodissociation and rapid-scan studies for two kinetic and spectral forms., Biochem Biophys Res Commun 187(1):94-100

 [7] Shepherd M., Achard ME., Idris A., Totsika M., Phan MD., Peters KM., Sarkar S., Ribeiro CA., Holyoake LV., Ladakis D., Ulett GC., Sweet MJ., Poole RK., McEwan AG., Schembri MA., 2016, The cytochrome bd-I respiratory oxidase augments survival of multidrug-resistant Escherichia coli during infection., Sci Rep 6:35285

 [8] Shipovskov S., Bonamore A., Boffi A., Ferapontova EE., 2015, Electrocatalytic interconversion of NADH and NAD(+) by Escherichia coli flavohemoglobin., Chem Commun (Camb) 51(89):16096-8

 [9] Sosna M., Bonamore A., Gorton L., Boffi A., Ferapontova EE., 2013, Direct electrochemistry and Os-polymer-mediated bioelectrocatalysis of NADH oxidation by Escherichia coli flavohemoglobin at graphite electrodes., Biosens Bioelectron 42:219-24

 [10] Tinajero-Trejo M., Denby KJ., Sedelnikova SE., Hassoubah SA., Mann BE., Poole RK., 2014, Carbon monoxide-releasing molecule-3 (CORM-3; Ru(CO)3Cl(glycinate)) as a tool to study the concerted effects of carbon monoxide and nitric oxide on bacterial flavohemoglobin Hmp: applications and pitfalls., J Biol Chem 289(43):29471-82

 [11] Vasudevan SG., Tang P., Dixon NE., Poole RK., 1995, Distribution of the flavohaemoglobin, HMP, between periplasm and cytoplasm in Escherichia coli., FEMS Microbiol Lett 125(2-3):219-24

 [12] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu蕞iz-Rascado L, Garc蕞a-Sotelo JS, Weiss V, Solano-Lira H, Mart蕞nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern蕞ndez S, Alquicira-Hern蕞ndez K, L蕞pez-Fuentes A, Porr蕞n-Sotelo L, Huerta AM, Bonavides-Mart蕞nez C, Balderas-Mart蕞nez YI, Pannier L, Olvera M, Labastida A, Jim蕞nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch蕞vez V, Hern蕞ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB