RegulonDB RegulonDB 10.8: Gene Form
   

hyaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hyaB hyaA hyaC serT hyaD NarP NarL ArcA NarP NarL Fis IscR IscR YdeO ArcA Fis anti-anti-terminator anti-terminator hyaAp hyaAp serTp serTp

Gene      
Name: hyaA    Texpresso search in the literature
Synonym(s): ECK0963, EG10468, b0972
Genome position(nucleotides): 1032139 --> 1033257 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.12
External database links:  
ASAP:
ABE-0003286
CGSC:
31781
ECHOBASE:
EB0463
OU-MICROARRAY:
b0972
PortEco:
hyaA
STRING:
511145.b0972
COLOMBOS: hyaA


Shine dalgarno      
Sequence: gtgtcgcaagGAGGAGagacgtgcgatATG


Product      
Name: hydrogenase 1 small subunit
Synonym(s): HyaA, hydrogenase 1 beta; subunit, hydrogenase 1 S subunit, hydrogenase 1 subunit HyaA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 40.681
Isoelectric point: 7.161
Motif(s):
 
Type Positions Sequence
46 -> 372 LENKPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRVVDIPQMGTHSTADTVGLTALGVVAAAVGVHAVASAVDQRRRHNQQPTETEHQPGNEDKQA
227 -> 308 YGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSF
165 -> 165 C
326 -> 348 TVGLTALGVVAAAVGVHAVASAV
1 -> 45 MNNEETFYQAMRRQGVTRRSFLKYCSLAATSLGLGAGMAPKIAWA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0009375 - ferredoxin hydrogenase complex
GO:0031237 - intrinsic component of periplasmic side of plasma membrane
GO:0044569 - [Ni-Fe] hydrogenase complex
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0008901 - ferredoxin hydrogenase activity
GO:0051538 - 3 iron, 4 sulfur cluster binding
GO:0033748 - hydrogenase (acceptor) activity
biological_process GO:0006113 - fermentation
GO:0009061 - anaerobic respiration
GO:0019645 - anaerobic electron transport chain
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
GO:1902421 - hydrogen metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47848N
ECOCYC:
HYAA-MONOMER
ECOLIWIKI:
b0972
INTERPRO:
IPR019546
INTERPRO:
IPR027394
INTERPRO:
IPR037148
INTERPRO:
IPR006137
INTERPRO:
IPR001821
INTERPRO:
IPR037024
INTERPRO:
IPR006311
MODBASE:
P69739
PANTHER:
PTHR30013
PDB:
6GAL
PDB:
6G7R
PDB:
6FPI
PDB:
5JRD
PDB:
5ADU
PDB:
5A4M
PDB:
5A4I
PDB:
5A4F
PDB:
4UE3
PDB:
4GD3
PDB:
3USE
PDB:
3USC
PDB:
3UQY
PDB:
6FPW
PFAM:
PF01058
PFAM:
PF14720
PRIDE:
P69739
PRINTS:
PR00614
PRODB:
PRO_000022943
PROSITE:
PS51318
REFSEQ:
NP_415491
SMR:
P69739
UNIPROT:
P69739


Operon      
Name: hyaABCDEF         
Operon arrangement:
Transcription unit        Promoter
hyaABCDEF


Transcriptional Regulation      
Display Regulation             
Activated by: YdeO, ArcA, AppY
Repressed by: IscR, NarL, NarP, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB