RegulonDB RegulonDB 10.7: Gene Form
   

hycF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hycE hycG hycF hycH hycI hycIp4 hycIp4 TSS_3021 TSS_3021

Gene      
Name: hycF    Texpresso search in the literature
Synonym(s): ECK2715, EG10479, b2720, hevF
Genome position(nucleotides): 2844210 <-- 2844752 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.62
External database links:  
ASAP:
ABE-0008942
CGSC:
33154
ECHOBASE:
EB0474
OU-MICROARRAY:
b2720
PORTECO:
hycF
REGULONDB:
b2720
STRING:
511145.b2720
M3D: hycF
COLOMBOS: hycF
PortEco: b2720


Product      
Name: formate hydrogenlyase subunit HycF
Synonym(s): HevF, HycF, formate hydrogenlyase complex, iron-sulfur protein HycF, hydrogenase 3, Fe-S subunit HycF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 20.309
Isoelectric point: 7.19
Motif(s):
 
Type Positions Sequence
66 -> 95 LAWEFNLGHCIFCGRCEEVCPTAAIKLSQE
39 -> 89 QCIGCAACVNACPSNALTVETDLATGELAWEFNLGHCIFCGRCEEVCPTAA
31 -> 60 GKPEQNPQQCIGCAACVNACPSNALTVETD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0045272 - plasma membrane respiratory chain complex I
molecular_function GO:0046872 - metal ion binding
GO:0016651 - oxidoreductase activity, acting on NAD(P)H
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0009060 - aerobic respiration
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
HYCF-MONOMER
ECOLIWIKI:
b2720
INTERPRO:
IPR017900
INTERPRO:
IPR017896
INTERPRO:
IPR010226
MINT:
P16432
MODBASE:
P16432
PANTHER:
PTHR10849
PFAM:
PF12838
PRIDE:
P16432
PRODB:
PRO_000022958
PROSITE:
PS51379
PROSITE:
PS00198
PROTEINMODELPORTAL:
P16432
REFSEQ:
NP_417200
SMR:
P16432
SWISSMODEL:
P16432
UNIPROT:
P16432


Operon      
Name: hycABCDEFGHI         
Operon arrangement:
Transcription unit        Promoter
hycABCDEFGHI


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, IHF, ModE
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3021 2843079 reverse nd [RS-EPT-CBR] [1]
  promoter hycIp4 2843102 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB