RegulonDB RegulonDB 10.7: Gene Form
   

hycG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hycE hycG hycF hycI hycH hycIp4 hycIp4 TSS_3021 TSS_3021

Gene      
Name: hycG    Texpresso search in the literature
Synonym(s): ECK2714, EG10480, b2719, hevG
Genome position(nucleotides): 2843443 <-- 2844210 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.38
External database links:  
ASAP:
ABE-0008936
CGSC:
33151
ECHOBASE:
EB0475
OU-MICROARRAY:
b2719
PORTECO:
hycG
REGULONDB:
b2719
STRING:
511145.b2719
M3D: hycG
COLOMBOS: hycG
PortEco: b2719


Product      
Name: formate hydrogenlyase subunit HycG
Synonym(s): HevG, HycG, formate hydrogenlyase complex, hydrogenase 3 subunit HycG, hydrogenase 3 small subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.999
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
57 -> 57 A
48 -> 157 CNGCEIEIFATLSPLFDAERFGIKVVPSPRHADILLFTGAVTRAMRSPALRAWQSAPDPKICISYGACGNSGGIFHDLYCVWGGTDKIVPVDVYIPGCPPTPAATLYGFA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0008137 - NADH dehydrogenase (ubiquinone) activity
GO:0048038 - quinone binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9977N
ECOCYC:
HYCG-MONOMER
ECOLIWIKI:
b2719
INTERPRO:
IPR006137
INTERPRO:
IPR006138
MINT:
P16433
MODBASE:
P16433
PANTHER:
PTHR11995
PFAM:
PF01058
PRIDE:
P16433
PRODB:
PRO_000022959
PROSITE:
PS01150
PROTEINMODELPORTAL:
P16433
REFSEQ:
NP_417199
SMR:
P16433
SWISSMODEL:
P16433
UNIPROT:
P16433


Operon      
Name: hycABCDEFGHI         
Operon arrangement:
Transcription unit        Promoter
hycABCDEFGHI


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, IHF, ModE
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3021 2843079 reverse nd [RS-EPT-CBR] [1]
  promoter hycIp4 2843102 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB