RegulonDB RegulonDB 10.7: Gene Form
   

hycH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ascB hycG hycF hycI hycH hycIp4 hycIp4 TSS_3021 TSS_3021

Gene      
Name: hycH    Texpresso search in the literature
Synonym(s): ECK2713, EG10481, b2718, hevH
Genome position(nucleotides): 2843036 <-- 2843446 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.8
External database links:  
ASAP:
ABE-0008933
CGSC:
33140
ECHOBASE:
EB0476
OU-MICROARRAY:
b2718
PORTECO:
hycH
REGULONDB:
b2718
STRING:
511145.b2718
M3D: hycH
COLOMBOS: hycH
PortEco: b2718


Product      
Name: formate hydrogenlyase assembly protein
Synonym(s): HevH, HycH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.465
Isoelectric point: 4.927
Motif(s):
 
Type Positions Sequence
81 -> 81 E
79 -> 79 Y
4 -> 133 KVVFSQLSRKFIDENDATPAEAQQVVYYSLAIGHHLGVIDCLEAALTCPWDEYLAWIATLEAGSEARRKMEGVPKYGEIVIDINHVPMLANAFDKARAAQTSQQQEWSTMLLSMLHDIHQENAIYLMVRR
37 -> 37 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0034622 - cellular protein-containing complex assembly
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IMP] Inferred from mutant phenotype
Reference(s): [1] Lindenstrauss U., et al., 2017
External database links:  
ECOCYC:
EG10481-MONOMER
ECOLIWIKI:
b2718
INTERPRO:
IPR010005
PFAM:
PF07450
PRIDE:
P0AEV7
PRODB:
PRO_000022960
PRODOM:
PD021295
PROTEINMODELPORTAL:
P0AEV7
REFSEQ:
NP_417198
UNIPROT:
P0AEV7


Operon      
Name: hycABCDEFGHI         
Operon arrangement:
Transcription unit        Promoter
hycABCDEFGHI


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, IHF, ModE
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3021 2843079 reverse nd [RS-EPT-CBR] [2]
  promoter hycIp4 2843102 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [2], [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Lindenstrauss U., Skorupa P., McDowall JS., Sargent F., Pinske C., 2017, The dual-function chaperone HycH improves assembly of the formate hydrogenlyase complex., Biochem J 474(17):2937-2950

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB