RegulonDB RegulonDB 10.6.3: Gene Form
   

zraR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

purH zraS zraR purD zraP ZraR ZraR CRP terminator anti-terminator anti-anti-terminator purDp1 purDp1 zraSp zraSp zraPp zraPp

Gene      
Name: zraR    Texpresso search in the literature
Synonym(s): ECK3996, EG10482, b4004, hydG
Genome position(nucleotides): 4203320 --> 4204645 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.26
External database links:  
ASAP:
ABE-0013093
CGSC:
34252
ECHOBASE:
EB0477
ECOCYC:
EG10482
ECOLIHUB:
zraR
OU-MICROARRAY:
b4004
REGULONDB:
b4004
STRING:
511145.b4004
M3D: zraR
COLOMBOS: zraR
PortEco: b4004


Product      
Name: DNA-binding transcriptional activator ZraR
Synonym(s): HydG, ZraR, ZraR response regulator
Sequence: Get amino acid sequence Fasta Format
Regulator Family: EBP
Cellular location: cytosol
Molecular weight: 48.395
Isoelectric point: 5.359
Motif(s):
 
Type Positions Sequence
232 -> 241 ADGGTLFLDE
385 -> 385 A
7 -> 121 DILVVDDDISHCTILQALLRGWGYNVALANSGRQALEQVREQVFDLVLCDVRMAEMDGIATLKEIKALNPAIPVLIMTAYSSVETAVEALKTGALDYLIKPLDFDNLQATLEKAL
141 -> 307 MVGKSPAMQHLLSEIALVAPSEATVLIHGDSGTGKELVARAIHASSARSEKPLVTLNCAALNESLLESELFGHEKGAFTGADKRREGRFVEADGGTLFLDEIGDISPMMQVRLLRAIQEREVQRVGSNQIISVDVRLIAATHRDLAAEVNAGRFRQDLYYRLNVVAI
228 -> 228 R

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0008134 - transcription factor binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000156 - phosphorelay response regulator activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
Evidence: [GEA] Gene expression analysis
[HIFS] Human inference of function from sequence
[IFC] Inferred by functional complementation
Reference(s): [1] Leonhartsberger S., et al., 2001
[2] Pao GM., et al., 1995
[3] Parkinson JS. 1993
[4] Parkinson JS., et al., 1992
[5] Stock JB., et al., 1990
External database links:  
DIP:
DIP-9980N
ECOCYC:
HYDG-MONOMER
ECOLIWIKI:
b4004
INTERPRO:
IPR025943
INTERPRO:
IPR027417
INTERPRO:
IPR025944
INTERPRO:
IPR025662
INTERPRO:
IPR011006
INTERPRO:
IPR009057
INTERPRO:
IPR003593
INTERPRO:
IPR002197
INTERPRO:
IPR002078
INTERPRO:
IPR001789
MODBASE:
P14375
PFAM:
PF00158
PFAM:
PF02954
PFAM:
PF00072
PRIDE:
P14375
PRINTS:
PR01590
PRODB:
PRO_000024256
PROSITE:
PS50045
PROSITE:
PS50110
PROSITE:
PS00675
PROSITE:
PS00676
PROSITE:
PS00688
PROTEINMODELPORTAL:
P14375
REFSEQ:
NP_418432
SMART:
SM00448
SMART:
SM00382
SMR:
P14375
SWISSMODEL:
P14375
UNIPROT:
P14375


Operon      
Name: zraSR         
Operon arrangement:
Transcription unit        Promoter
zraSR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, ZraR
Growth Conditions:

[1] 

C: Escherichia coli| LB medium| ZnCl2 1 mM; glucose 0.4%| oxygen atom| OD600 from 0.4 to 0.6
E: Escherichia coli| hydH knockout mutant| LB medium| ZnCl2 1 mM; glucose 0.4%| oxygen atom| OD600 from 0.4 to 0.6

[2] 

C: Escherichia coli| LB medium| glucose 0.4%| oxygen atom| OD600 from 0.4 to 0.6
E: Escherichia coli| LB medium| ZnCl2 0.2 to 1 mM; glucose 0.4%| oxygen atom| OD600 from 0.4 to 0.6

[3] 

C: Escherichia coli| LB medium| ZnCl2 1 mM; glucose 0.4%| oxygen atom| OD600 from 0.4 to 0.6
E: Escherichia coli| hydG knockout mutant| LB medium| ZnCl2 1 mM; glucose 0.4%| oxygen atom| OD600 from 0.4 to 0.6

[4] 

C: Escherichia coli| LB medium| glucose 0.4%| oxygen atom| OD600 from 0.4 to 0.6
E: Escherichia coli| LB medium| cadmium dichloride 0.5 mM; glucose 0.4%| oxygen atom| OD600 from 0.4 to 0.6

[5] 

C: Escherichia coli| LB medium| glucose 0.4%| oxygen atom| OD600 from 0.4 to 0.6
E: Escherichia coli| LB medium| PbCl2 1 mM; glucose 0.4%| oxygen atom| OD600 from 0.4 to 0.6



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter purDp1 4205986 reverse Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Leonhartsberger S., Huber A., Lottspeich F., Bock A., 2001, The hydH/G Genes from Escherichia coli code for a zinc and lead responsive two-component regulatory system., J Mol Biol 307(1):93-105

 [2] Pao GM., Saier MH., 1995, Response regulators of bacterial signal transduction systems: selective domain shuffling during evolution., J Mol Evol 40(2):136-54

 [3] Parkinson JS., 1993, Signal transduction schemes of bacteria., Cell 73(5):857-71

 [4] Parkinson JS., Kofoid EC., 1992, Communication modules in bacterial signaling proteins., Annu Rev Genet 26:71-112

 [5] Stock JB., Stock AM., Mottonen JM., 1990, Signal transduction in bacteria., Nature 344(6265):395-400

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB