RegulonDB RegulonDB 10.7: Gene Form
   

hypA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hypB hycA hypA hypC FNR FNR ModE FhlA FhlA NsrR IHF hypBp hypBp hypAp hypAp hycAp hycAp

Gene      
Name: hypA    Texpresso search in the literature
Synonym(s): ECK2721, EG10483, b2726
Genome position(nucleotides): 2850647 --> 2850997 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.99
External database links:  
ASAP:
ABE-0008958
CGSC:
33104
ECHOBASE:
EB0478
OU-MICROARRAY:
b2726
PORTECO:
hypA
REGULONDB:
b2726
STRING:
511145.b2726
M3D: hypA
COLOMBOS: hypA
PortEco: b2726


Shine dalgarno      
Sequence: atagttaatgGGAGGCgatATG


Product      
Name: hydrogenase 3 nickel incorporation protein HypA
Synonym(s): HypA, accessory protein for nickel incorporation into hydrogenase 3
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 13.168
Isoelectric point: 5.181
Motif(s):
 
Type Positions Sequence
2 -> 2 H
1 -> 113 MHEITLCQRALELIEQQAAKHGAKRVTGVWLKIGAFSCVETSSLAFCFDLVCRGSVAEGCKLHLEEQEAECWCETCQQYVTLLTQRVRRCPQCHGDMLQIVADDGLQIRRIEI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0031234 - extrinsic component of cytoplasmic side of plasma membrane
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016151 - nickel cation binding
GO:0008270 - zinc ion binding
biological_process GO:0006464 - cellular protein modification process
GO:0051604 - protein maturation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Jacobi A., et al., 1992
External database links:  
DIP:
DIP-48022N
ECOCYC:
EG10483-MONOMER
ECOLIWIKI:
b2726
INTERPRO:
IPR000688
INTERPRO:
IPR020538
PANTHER:
PTHR34535
PFAM:
PF01155
PRIDE:
P0A700
PRODB:
PRO_000022972
PROSITE:
PS01249
PROTEINMODELPORTAL:
P0A700
REFSEQ:
NP_417206
SMR:
P0A700
UNIPROT:
P0A700


Operon      
Name: hypABCDE-fhlA         
Operon arrangement:
Transcription unit        Promoter
hypABCDE
hypABCDE-fhlA
hypBCDE
hypBCDE-fhlA


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, IHF
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jacobi A., Rossmann R., Bock A., 1992, The hyp operon gene products are required for the maturation of catalytically active hydrogenase isoenzymes in Escherichia coli., Arch Microbiol 158(6):444-51


RegulonDB