RegulonDB RegulonDB 10.7: Gene Form
   

hypC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hypD hypE hypB hypA hypC FNR FNR ModE hypBp hypBp

Gene      
Name: hypC    Texpresso search in the literature
Synonym(s): ECK2723, EG10485, b2728
Genome position(nucleotides): 2851864 --> 2852136 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.31
External database links:  
ASAP:
ABE-0008962
CGSC:
33113
ECHOBASE:
EB0480
OU-MICROARRAY:
b2728
PORTECO:
hypC
REGULONDB:
b2728
STRING:
511145.b2728
M3D: hypC
COLOMBOS: hypC
PortEco: b2728


Shine dalgarno      
Sequence: tgaactggctGGAGACacagcgATG


Product      
Name: hydrogenase 3 maturation protein HypC
Synonym(s): HypC, HypC, protein involved in hydrogenase 3 maturation
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.732
Isoelectric point: 3.961
Motif(s):
 
Type Positions Sequence
2 -> 2 C
6 -> 6 P
1 -> 71 MCIGVPGQIRTIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRVGQWVLVHVGFAMSVINEAEARDTLDAL
51 -> 51 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0005506 - iron ion binding
GO:0042802 - identical protein binding
GO:1902670 - carbon dioxide binding
biological_process GO:0051604 - protein maturation
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Drapal N., et al., 1998
[2] Hartwig S., et al., 2015
External database links:  
DIP:
DIP-36430N
ECOCYC:
EG10485-MONOMER
ECOLIWIKI:
b2728
INTERPRO:
IPR037254
INTERPRO:
IPR001109
INTERPRO:
IPR019812
MINT:
MINT-1223094
PANTHER:
PTHR35177
PDB:
2OT2
PFAM:
PF01455
PRIDE:
P0AAM3
PRINTS:
PR00445
PRODB:
PRO_000022974
PROSITE:
PS01097
PROTEINMODELPORTAL:
P0AAM3
REFSEQ:
NP_417208
SMR:
P0AAM3
UNIPROT:
P0AAM3


Operon      
Name: hypABCDE-fhlA         
Operon arrangement:
Transcription unit        Promoter
hypABCDE
hypABCDE-fhlA
hypBCDE
hypBCDE-fhlA


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, FNR, IHF
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Drapal N., Bock A., 1998, Interaction of the hydrogenase accessory protein HypC with HycE, the large subunit of Escherichia coli hydrogenase 3 during enzyme maturation., Biochemistry 37(9):2941-8

 [2] Hartwig S., Thomas C., Krumova N., Quitzke V., Turkowsky D., Jehmlich N., Adrian L., Sawers RG., 2015, Heterologous complementation studies in Escherichia coli with the Hyp accessory protein machinery from Chloroflexi provide insight into [NiFe]-hydrogenase large subunit recognition by the HypC protein family., Microbiology 161(11):2204-19


RegulonDB