RegulonDB RegulonDB 10.7: Gene Form
   

hypD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fhlA hypD hypE hypB hypC OxyS OxyS terminator

Gene      
Name: hypD    Texpresso search in the literature
Synonym(s): ECK2724, EG10486, b2729, hydF
Genome position(nucleotides): 2852136 --> 2853257 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.44
External database links:  
ASAP:
ABE-0008965
CGSC:
33116
ECHOBASE:
EB0481
OU-MICROARRAY:
b2729
PORTECO:
hypD
REGULONDB:
b2729
STRING:
511145.b2729
M3D: hypD
COLOMBOS: hypD
PortEco: b2729


Shine dalgarno      
Sequence: gttgtatggcGAGGAAaaataATG


Product      
Name: Fe-(CN)2CO cofactor assembly scaffold protein HypD
Synonym(s): HydF, HypD, HypD, scaffold protein for assembly of the Fe-(CN)2CO cofactor
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.363
Isoelectric point: 6.186
Motif(s):
 
Type Positions Sequence
15 -> 367 QLIEHLRERASHLSYTAERPLRIMEVCGGHTHAIFKFGLDQLLPENVEFIHGPGCPVCVLPMGRIDTCVEIASHPEVIFCTFGDAMRVPGKQGSLLQAKARGADVRIVYSPMDALKLAQENPTRKVVFFGLGFETTMPTTAITLQQAKARDVQNFYFFCQHITLIPTLRSLLEQPDNGIDAFLAPGHVSMVIGTDAYNFIASDFHRPLVVAGFEPLDLLQGVVMLVQQKIAAHSKVENQYRRVVPDAGNLLAQQAIADVFCVNGDSEWRGLGVIESSGVHLTPDYQRFDAEAHFRPAPQQVCDDPRARCGEVLTGKCKPHQCPLFGNTCNPQTAFGALMVSSEGACAAWYQYR
72 -> 72 C
41 -> 41 C
69 -> 69 C
357 -> 357 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0005506 - iron ion binding
GO:0070025 - carbon monoxide binding
biological_process GO:0006464 - cellular protein modification process
GO:0051604 - protein maturation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Jacobi A., et al., 1992
[2] Sankar P., et al., 1988
[3] Stoker K., et al., 1989
[4] Stripp ST., et al., 2014
External database links:  
DIP:
DIP-9998N
ECOCYC:
EG10486-MONOMER
ECOLIWIKI:
b2729
INTERPRO:
IPR002780
INTERPRO:
IPR042244
INTERPRO:
IPR042243
MINT:
MINT-1239502
PANTHER:
PTHR30149
PFAM:
PF01924
PRIDE:
P24192
PRODB:
PRO_000022975
PROTEINMODELPORTAL:
P24192
REFSEQ:
NP_417209
SMR:
P24192
UNIPROT:
P24192


Operon      
Name: hypABCDE-fhlA         
Operon arrangement:
Transcription unit        Promoter
hypABCDE
hypABCDE-fhlA
hypBCDE
hypBCDE-fhlA


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, FNR, IHF
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jacobi A., Rossmann R., Bock A., 1992, The hyp operon gene products are required for the maturation of catalytically active hydrogenase isoenzymes in Escherichia coli., Arch Microbiol 158(6):444-51

 [2] Sankar P., Shanmugam KT., 1988, Hydrogen metabolism in Escherichia coli: biochemical and genetic evidence for a hydF gene., J Bacteriol 170(12):5446-51

 [3] Stoker K., Oltmann LF., Stouthamer AH., 1989, Randomly induced Escherichia coli K-12 Tn5 insertion mutants defective in hydrogenase activity., J Bacteriol 171(2):831-6

 [4] Stripp ST., Lindenstrauss U., Granich C., Sawers RG., Soboh B., 2014, The influence of oxygen on [NiFe]-hydrogenase cofactor biosynthesis and how ligation of carbon monoxide precedes cyanation., PLoS One 9(9):e107488


RegulonDB