RegulonDB RegulonDB 10.8: Gene Form
   

iap gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

iap cysD cas2 CysB TSS_3042 TSS_3042 iapp6 iapp6 iapp7 iapp7 TSS_3041 TSS_3041 cysDp cysDp TSS_3040 TSS_3040 TSS_3039 TSS_3039

Gene      
Name: iap    Texpresso search in the literature
Synonym(s): ECK2748, EG10488, b2753
Genome position(nucleotides): 2876581 --> 2877618 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.33
External database links:  
ASAP:
ABE-0009033
CGSC:
616
ECHOBASE:
EB0483
OU-MICROARRAY:
b2753
PortEco:
iap
STRING:
511145.b2753
COLOMBOS: iap


Product      
Name: alkaline phosphatase isozyme conversion protein
Synonym(s): Iap
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 37.92
Isoelectric point: 9.458
Motif(s):
 
Type Positions Sequence
100 -> 330 VIAAHEGKAPQQIIIMAHLDTYAPLSDADADANLGGLTLQGMDDNAAGLGVMLELAERLKNTPTEYGIRFVATSGEEEGKLGAENLLKRMSDTEKKNTLLVINLDNLIVGDKLYFNSGVKTPEAVRKLTRDRALAIARSHGIAATTNPGLNKNYPKGTGCCNDAEIFDKAGIAVLSVEATNWNLGNKDGYQQRAKTPAFPAGNSWHDVRLDNHQHIDKALPGRIERRCRDV
25 -> 345 SSPKPGDFANTQARHIATFFPGRMTGTPAEMLSADYIRQQFQQMGYRSDIRTFNSRYIYTARDNRKSWHNVTGSTVIAAHEGKAPQQIIIMAHLDTYAPLSDADADANLGGLTLQGMDDNAAGLGVMLELAERLKNTPTEYGIRFVATSGEEEGKLGAENLLKRMSDTEKKNTLLVINLDNLIVGDKLYFNSGVKTPEAVRKLTRDRALAIARSHGIAATTNPGLNKNYPKGTGCCNDAEIFDKAGIAVLSVEATNWNLGNKDGYQQRAKTPAFPAGNSWHDVRLDNHQHIDKALPGRIERRCRDVMRIMLPLVKELAKAS
1 -> 24 MFSALRHRTAALALGVCFILPVHA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004177 - aminopeptidase activity
biological_process GO:0006508 - proteolysis
GO:0043687 - post-translational protein modification
Note(s): Note(s): ...[more].
Reference(s): [1] Nakata A., et al., 1980
[2] Nakata A., et al., 1982
External database links:  
ECOCYC:
EG10488-MONOMER
ECOLIWIKI:
b2753
INTERPRO:
IPR007484
MODBASE:
P10423
PFAM:
PF04389
PRIDE:
P10423
REFSEQ:
NP_417233
SMR:
P10423
UNIPROT:
P10423


Operon      
Name: iap         
Operon arrangement:
Transcription unit        Promoter
iap


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3039 2875496 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3040 2875544 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3041 2876370 reverse nd [RS-EPT-CBR] [3]
  promoter iapp7 2876536 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter iapp6 2876544 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_3042 2876547 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Nakata A., Kawamata J., 1980, Dominance of alkaline phosphatase isozyme gene (IAP+) of Escherichia coli K-12., Biken J 23(1):49-51

 [2] Nakata A., Shinagawa H., Amemura M., 1982, Cloning of alkaline phosphatase isozyme gene (iap) of Escherichia coli., Gene 19(3):313-9

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB