RegulonDB RegulonDB 10.9: Gene Form
   

ilvA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ilvD ilvA ilvY ilvAp ilvAp TSS_4395 TSS_4395

Gene      
Name: ilvA    Texpresso search in the literature
Synonym(s): ECK3764, EG10493, b3772, ile
Genome position(nucleotides): 3955331 --> 3956875 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.77
External database links:  
ASAP:
ABE-0012321
CGSC:
609
ECHOBASE:
EB0488
ECOLIHUB:
ilvA
OU-MICROARRAY:
b3772
STRING:
511145.b3772
COLOMBOS: ilvA


Product      
Name: threonine deaminase
Synonym(s): Ile, IlvA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 56.195
Isoelectric point: 5.728
Motif(s):
 
Type Positions Sequence
140 -> 140 A
425 -> 512 GRPSHPLQERLYSFEFPESPGALLRFLNTLGTYWNISLFHYRSHGTDYGRVLAAFELGDHEPDFETRLNELGYDCHDETNNPAFRFFL
189 -> 192 GGGL
120 -> 120 A
29 -> 316 AQVTPLQKMEKLSSRLDNVILVKREDRQPVHSFKLRGAYAMMAGLTEEQKAHGVITASAGNHAQGVAFSSARLGVKALIVMPTATADIKVDAVRGFGGEVLLHGANFDEAKAKAIELSQQQGFTWVPPFDHPMVIAGQGTLALELLQQDAHLDRVFVPVGGGGLAAGVAVLIKQLMPQIKVIAVEAEDSACLKAALDAGHPVDLPRVGLFAEGVAVKRIGDETFRLCQEYLDDIITVDSDAICAAMKDLFEDVRAVAEPSGALALAGMKKYIALHNIRGERLAHILSG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.18 - isoleucine/valine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0016597 - amino acid binding
GO:0030170 - pyridoxal phosphate binding
GO:0004794 - L-threonine ammonia-lyase activity
biological_process GO:0008152 - metabolic process
GO:0006520 - cellular amino acid metabolic process
GO:0006566 - threonine metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009082 - branched-chain amino acid biosynthetic process
GO:0006567 - threonine catabolic process
GO:0009097 - isoleucine biosynthetic process
External database links:  
DIP:
DIP-10018N
ECOCYC:
THREDEHYDSYN-MONOMER
ECOLIWIKI:
b3772
INTERPRO:
IPR000634
INTERPRO:
IPR038110
INTERPRO:
IPR001721
INTERPRO:
IPR001926
INTERPRO:
IPR005787
INTERPRO:
IPR036052
MODBASE:
P04968
PDB:
1TDJ
PFAM:
PF00291
PFAM:
PF00585
PRIDE:
P04968
PRODB:
PRO_000023001
PROSITE:
PS51672
PROSITE:
PS00165
REFSEQ:
NP_418220
SMR:
P04968
UNIPROT:
P04968


Operon      
Name: ilvLXGMEDA         
Operon arrangement:
Transcription unit        Promoter
ilvL
ilvLXG_1G_2MEDA
ilvL
ilvLXG_1G_2MEDA
ilvEDA
ilvA


Transcriptional Regulation      
Display Regulation             
Activated by: IHF
Repressed by: IHF, Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4395 3954417 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB