RegulonDB RegulonDB 10.6.3: Gene Form
   

ilvC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ilvC ilvY ppiC IlvY IlvY TSS_4403 TSS_4403 TSS_4402 TSS_4402 TSS_4401 TSS_4401 TSS_4400 TSS_4400 TSS_4399 TSS_4399 TSS_4398 TSS_4398 TSS_4397 TSS_4397 ilvCp ilvCp ilvYp ilvYp TSS_4396 TSS_4396

Gene      
Name: ilvC    Texpresso search in the literature
Synonym(s): ECK3766, EG10495, b3774
Genome position(nucleotides): 3957970 --> 3959445 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.79
External database links:  
ASAP:
ABE-0012331
CGSC:
607
ECHOBASE:
EB0490
ECOCYC:
EG10495
ECOLIHUB:
ilvC
OU-MICROARRAY:
b3774
REGULONDB:
b3774
STRING:
511145.b3774
M3D: ilvC
COLOMBOS: ilvC
PortEco: b3774


Shine dalgarno      
Sequence: cacaacatcaCGAGGAatcaccATG


Product      
Name: ketol-acid reductoisomerase (NADP+)
Synonym(s): IlvC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 54.069
Isoelectric point: 4.965
Motif(s):
 
Type Positions Sequence
2 -> 491 ANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDSGLDISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVINLTPDKQHSDVVRTVQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAGSLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQLKEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEGKIGEQEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYGNYLFSYACVPLLKPFMAELQPGDLGKAIPEGAVDNGQLRDVNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG
69 -> 69 K
76 -> 76 R
108 -> 110 DKQ
345 -> 484 YEGKIGEQEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYGNYLFSYACVPLLKPFMAELQPGDLGKAIPEGAVDNGQLRDVNEAIRSHAIEQVGKKLRGYMTDM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.18 - isoleucine/valine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004455 - ketol-acid reductoisomerase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0050661 - NADP binding
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0009082 - branched-chain amino acid biosynthetic process
GO:0009099 - valine biosynthetic process
GO:0009097 - isoleucine biosynthetic process
GO:0055114 - oxidation-reduction process
GO:0051289 - protein homotetramerization
External database links:  
ECOCYC:
KETOLREDUCTOISOM-MONOMER
ECOLIWIKI:
b3774
INTERPRO:
IPR036291
INTERPRO:
IPR013328
INTERPRO:
IPR013116
INTERPRO:
IPR013023
INTERPRO:
IPR008927
INTERPRO:
IPR000506
MODBASE:
P05793
PANTHER:
PTHR21371
PDB:
1YRL
PDB:
3ULK
PFAM:
PF07991
PFAM:
PF01450
PRIDE:
P05793
PRODB:
PRO_000023003
PROSITE:
PS51851
PROSITE:
PS51850
PROTEINMODELPORTAL:
P05793
REFSEQ:
NP_418222
SMR:
P05793
UNIPROT:
P05793


Operon      
Name: ilvC         
Operon arrangement:
Transcription unit        Promoter
ilvC


Transcriptional Regulation      
Display Regulation             
Activated by: IlvY


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4396 3957864 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4397 3957916 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4398 3957937 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4399 3957995 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4400 3958227 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4401 3958729 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4402 3959129 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4403 3959136 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB