RegulonDB RegulonDB 10.6.3: Gene Form
   

ilvH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ilvI cra ilvH fruL terminator anti-terminator anti-anti-terminator TSS_153 TSS_153 fruRp8 fruRp8 TSS_152 TSS_152 TSS_151 TSS_151 TSS_150 TSS_150

Gene      
Name: ilvH    Texpresso search in the literature
Synonym(s): ECK0080, EG10499, b0078, brnP
Genome position(nucleotides): 87357 --> 87848 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.2
External database links:  
ASAP:
ABE-0000294
CGSC:
602
ECHOBASE:
EB0494
ECOCYC:
EG10499
ECOLIHUB:
ilvH
OU-MICROARRAY:
b0078
REGULONDB:
b0078
STRING:
511145.b0078
M3D: ilvH
COLOMBOS: ilvH
PortEco: b0078


Product      
Name: acetolactate synthase / acetohydroxybutanoate synthase, regulatory subunit
Synonym(s): BrnP, IlvH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.977
Isoelectric point: 8.946
Motif(s):
 
Type Positions Sequence
4 -> 78 ILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQ
84 -> 158 REIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSLYTVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRG
12 -> 73 ESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQIEKQLHKLVDVLRV
132 -> 132 D
159 -> 163 DKIMR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.18 - isoleucine/valine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005948 - acetolactate synthase complex
molecular_function GO:0016740 - transferase activity
GO:0003984 - acetolactate synthase activity
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0009082 - branched-chain amino acid biosynthetic process
GO:0009099 - valine biosynthetic process
GO:0009097 - isoleucine biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10024N
ECOCYC:
ACETOLACTSYNIII-HCHAIN-MONOMER
ECOLIWIKI:
b0078
INTERPRO:
IPR027271
INTERPRO:
IPR039557
INTERPRO:
IPR019455
INTERPRO:
IPR004789
INTERPRO:
IPR002912
MODBASE:
P00894
PANTHER:
PTHR30239
PDB:
2F1F
PFAM:
PF10369
PRIDE:
P00894
PRODB:
PRO_000023007
PROSITE:
PS51671
PROTEINMODELPORTAL:
P00894
REFSEQ:
NP_414620
SMR:
P00894
SWISSMODEL:
P00894
UNIPROT:
P00894


Operon      
Name: ilvIH         
Operon arrangement:
Transcription unit        Promoter
ilvIH
ilvIH
ilvIH
ilvIH


Transcriptional Regulation      
Display Regulation             
Activated by: Lrp
Repressed by: H-NS, Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_150 86542 forward nd [RS-EPT-CBR] [1]
  promoter TSS_151 86559 forward nd [RS-EPT-CBR] [1]
  promoter TSS_152 87478 forward nd [RS-EPT-CBR] [1]
  promoter TSS_153 87969 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB