RegulonDB RegulonDB 10.6.3: Gene Form
   

ilvI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ilvI ilvH yabR Lrp Lrp Lrp ppGpp anti-terminator anti-anti-terminator terminator anti-terminator TSS_152 TSS_152 TSS_151 TSS_151 TSS_150 TSS_150 ilvIHp1 ilvIHp1 TSS_149 TSS_149 ilvIp2 ilvIp2

Gene      
Name: ilvI    Texpresso search in the literature
Synonym(s): ECK0079, EG10500, b0077
Genome position(nucleotides): 85630 --> 87354 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.93
Reference(s): [1] Haughn GW., et al., 1985
External database links:  
ASAP:
ABE-0000290
CGSC:
601
ECHOBASE:
EB0495
ECOCYC:
EG10500
ECOLIHUB:
ilvI
OU-MICROARRAY:
b0077
REGULONDB:
b0077
STRING:
511145.b0077
M3D: ilvI
COLOMBOS: ilvI
PortEco: b0077


Product      
Name: acetolactate synthase / acetohydroxybutanoate synthase, catalytic subunit
Synonym(s): IlvI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 62.984
Isoelectric point: 6.287
Motif(s):
 
Type Positions Sequence
5 -> 168 SGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILNP
202 -> 203 TL
437 -> 438 LP
507 -> 509 LAE
196 -> 330 IKRALQTLVAAKKPVVYVGGGAITAGCHQQLKETVEALNLPVVCSLMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGVRFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVTADIPIVGDARQVLEQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.18 - isoleucine/valine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0050660 - flavin adenine dinucleotide binding
GO:0003984 - acetolactate synthase activity
GO:0000287 - magnesium ion binding
GO:0030976 - thiamine pyrophosphate binding
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0009082 - branched-chain amino acid biosynthetic process
GO:0009099 - valine biosynthetic process
GO:0009097 - isoleucine biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-6850N
ECOCYC:
ACETOLACTSYNIII-ICHAIN-MONOMER
ECOLIWIKI:
b0077
INTERPRO:
IPR029035
INTERPRO:
IPR039368
INTERPRO:
IPR029061
INTERPRO:
IPR012846
INTERPRO:
IPR012001
INTERPRO:
IPR012000
INTERPRO:
IPR011766
INTERPRO:
IPR000399
MODBASE:
P00893
PANTHER:
PTHR18968:SF13
PFAM:
PF02776
PFAM:
PF00205
PFAM:
PF02775
PRIDE:
P00893
PRODB:
PRO_000023008
PROSITE:
PS00187
PROTEINMODELPORTAL:
P00893
REFSEQ:
YP_025294
SMR:
P00893
UNIPROT:
P00893


Operon      
Name: ilvIH         
Operon arrangement:
Transcription unit        Promoter
ilvIH
ilvIH
ilvIH
ilvIH


Transcriptional Regulation      
Display Regulation             
Activated by: Lrp
Repressed by: H-NS, Lrp


RNA cis-regulatory element    
Attenuation: Transcriptional


Regulation by small RNA    
  Display Regulation
small RNA dsrA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_149 85599 forward nd [RS-EPT-CBR] [2]
  promoter TSS_150 86542 forward nd [RS-EPT-CBR] [2]
  promoter TSS_151 86559 forward nd [RS-EPT-CBR] [2]
  promoter TSS_152 87478 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Haughn GW., Squires CH., De Felice M., Largo CT., Calvo JM., 1985, Unusual organization of the ilvIH promoter of Escherichia coli., J Bacteriol 163(1):186-98

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB