RegulonDB RegulonDB 10.9: Gene Form
   

ilvN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ilvB uhpA ilvN anti-terminator terminator TSS_4250 TSS_4250 uhpBp uhpBp

Gene      
Name: ilvN    Texpresso search in the literature
Synonym(s): ECK3661, EG10502, b3670
Genome position(nucleotides): 3850802 <-- 3851092 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.45
External database links:  
ASAP:
ABE-0011997
CGSC:
15441
ECHOBASE:
EB0497
ECOLIHUB:
ilvN
OU-MICROARRAY:
b3670
STRING:
511145.b3670
COLOMBOS: ilvN


Product      
Name: acetohydroxy acid synthase I subunit IlvN
Synonym(s): IlvN, acetohydroxy acid synthase I, small subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.106
Isoelectric point: 6.071
Motif(s):
 
Type Positions Sequence
10 -> 83 ILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQRLEQMISQIDKLEDVVKVQRNQS
24 -> 24 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.18 - isoleucine/valine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005948 - acetolactate synthase complex
molecular_function GO:1990610 - acetolactate synthase regulator activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0003984 - acetolactate synthase activity
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0009082 - branched-chain amino acid biosynthetic process
GO:0009099 - valine biosynthetic process
GO:0050790 - regulation of catalytic activity
GO:0009097 - isoleucine biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
SMALLILVN-MONOMER
ECOLIWIKI:
b3670
INTERPRO:
IPR039557
INTERPRO:
IPR004789
INTERPRO:
IPR002912
PANTHER:
PTHR30239
PDB:
5YUM
PDB:
2LVW
PDB:
5YPY
PDB:
5YPP
PFAM:
PF01842
PRIDE:
P0ADF8
PRODB:
PRO_000023010
PROSITE:
PS51671
REFSEQ:
NP_418126
SMR:
P0ADF8
UNIPROT:
P0ADF8


Operon      
Name: ivbL-ilvBN-uhpABC         
Operon arrangement:
Transcription unit        Promoter
uhpB
ivbL
ivbL-ilvBN
ivbL-ilvBN-uhpABC
uhpABC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4250 3850755 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB