RegulonDB RegulonDB 10.6.3: Gene Form
   

ilvY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ilvA ilvC ilvY IlvY IlvY TSS_4403 TSS_4403 TSS_4402 TSS_4402 TSS_4401 TSS_4401 TSS_4400 TSS_4400 TSS_4399 TSS_4399 TSS_4398 TSS_4398 TSS_4397 TSS_4397 ilvCp ilvCp ilvYp ilvYp TSS_4396 TSS_4396

Gene      
Name: ilvY    Texpresso search in the literature
Synonym(s): ECK3765, EG10503, b3773
Genome position(nucleotides): 3956927 <-- 3957820 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.61
External database links:  
ASAP:
ABE-0012323
CGSC:
598
ECHOBASE:
EB0498
ECOCYC:
EG10503
ECOLIHUB:
ilvY
OU-MICROARRAY:
b3773
REGULONDB:
b3773
STRING:
511145.b3773
M3D: ilvY
COLOMBOS: ilvY
PortEco: b3773


Shine dalgarno      
Sequence: acgtcaacatCGAGGGctgtcccTGT


Product      
Name: DNA-binding transcriptional dual regulator IlvY
Synonym(s): IlvY, positive regulator for ilvC
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 33.204
Isoelectric point: 6.854
Motif(s):
 
Type Positions Sequence
1 -> 58 MDLRDLKTFLHLAESRHFGRSARAMHVSPSTLSRQIQRLEEDLGQPLFVRDNRTVTLT
89 -> 293 LSGELHIFCSVTAAYSHLPPILDRFRAEHPSVEIKLTTGDAADAMEKVVTGEADLAIAGKPETLPGAVAFSMLENLAVVLIAPALPCPVRNQVSVEKPDWSTVPFIMADQGPVRRRIELWFRRNKISNPMIYATVGGHEAMVSMVALGCGVALLPEVVLENSPEPVRNRVMILERSDEKTPFELGVCAQKKRLHEPLIEAFWKIL
3 -> 62 LRDLKTFLHLAESRHFGRSARAMHVSPSTLSRQIQRLEEDLGQPLFVRDNRTVTLTEAGE
18 -> 37 FGRSARAMHVSPSTLSRQIQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.18 - isoleucine/valine
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0008652 - cellular amino acid biosynthetic process
GO:0009082 - branched-chain amino acid biosynthetic process
Reference(s): [1] Daniels DL., et al., 1992
[2] Watson MD., et al., 1979
[3] Wek RC., et al., 1986
[4] Wek RC., et al., 1988
External database links:  
DIP:
DIP-10028N
ECOCYC:
PD00200
ECOLIWIKI:
b3773
INTERPRO:
IPR037404
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR000847
INTERPRO:
IPR005119
MODBASE:
P05827
PFAM:
PF03466
PFAM:
PF00126
PRIDE:
P05827
PRINTS:
PR00039
PROSITE:
PS50931
PROTEINMODELPORTAL:
P05827
REFSEQ:
NP_418221
SMR:
P05827
UNIPROT:
P05827


Operon      
Name: ilvY         
Operon arrangement:
Transcription unit        Promoter
ilvY


Transcriptional Regulation      
Display Regulation             
Repressed by: IlvY


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4396 3957864 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_4397 3957916 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4398 3957937 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4399 3957995 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4400 3958227 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4401 3958729 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4402 3959129 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4403 3959136 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Daniels DL., Plunkett G., Burland V., Blattner FR., 1992, Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes., Science 257(5071):771-8

 [2] Watson MD., Wild J., Umbarger HE., 1979, Positive control of ilvC expression in Escherichia coli K-12; identification and mapping of regulatory gene ilvY., J Bacteriol 139(3):1014-20

 [3] Wek RC., Hatfield GW., 1986, Nucleotide sequence and in vivo expression of the ilvY and ilvC genes in Escherichia coli K12. Transcription from divergent overlapping promoters., J Biol Chem 261(5):2441-50

 [4] Wek RC., Hatfield GW., 1988, Transcriptional activation at adjacent operators in the divergent-overlapping ilvY and ilvC promoters of Escherichia coli., J Mol Biol 203(3):643-63

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB