RegulonDB RegulonDB 10.8: Gene Form
   

intD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

intD insEF3 insF3 unknown peaD insE3 exoD xisD argU terminator intDp6 intDp6 TSS_682 TSS_682

Gene      
Name: intD    Texpresso search in the literature
Synonym(s): ECK0530, EG10507, b0537, int
Genome position(nucleotides): 564815 <-- 565978 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.91
External database links:  
ASAP:
ABE-0001842
ECHOBASE:
EB0502
OU-MICROARRAY:
b0537
PortEco:
intD
STRING:
511145.b0537
COLOMBOS: intD


Product      
Name: DLP12 prophage; putative integrase
Synonym(s): Int, IntD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 45.09
Isoelectric point: 10.452
Motif(s):
 
Type Positions Sequence
181 -> 362 KRVRWLEKEEAKRLIDECPEPLKSVVKFALATGLRKSNIINLEWQQIDMQRRVAWVNPEESKSNRAIGVALNDTACKVLRDQIGKHHKWVFVHTKAAKRADGTSTPAVRKMRIDSKTSWLSACRRAGIEDFRFHDLRHTWASWLIQSGVPLSVLQEMGGWESIEMVRRYAHLAPNHLTEHAR
185 -> 353 WLEKEEAKRLIDECPEPLKSVVKFALATGLRKSNIINLEWQQIDMQRRVAWVNPEESKSNRAIGVALNDTACKVLRDQIGKHHKWVFVHTKAAKRADGTSTPAVRKMRIDSKTSWLSACRRAGIEDFRFHDLRHTWASWLIQSGVPLSVLQEMGGWESIEMVRRYAHLA
57 -> 161 VTFEEACLRWLEEKADKKSLDSDKSRIEFWLEHFEGIRLKDISEAKIYSAVSRMHNRKTKEIWKQKVQAAIRKGKELPVYEPKPVSTQTKAKHLAMIKAILRAAE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0008979 - prophage integrase activity
biological_process GO:0044826 - viral genome integration into host DNA
GO:0006310 - DNA recombination
GO:0015074 - DNA integration
GO:0046718 - viral entry into host cell
GO:0075713 - establishment of integrated proviral latency
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10507-MONOMER
ECOLIWIKI:
b0537
INTERPRO:
IPR002104
INTERPRO:
IPR013762
INTERPRO:
IPR011010
INTERPRO:
IPR010998
MODBASE:
P24218
PFAM:
PF00589
PRIDE:
P24218
PRODB:
PRO_000023026
PROSITE:
PS51900
PROSITE:
PS51898
REFSEQ:
NP_415069
SMR:
P24218
UNIPROT:
P24218


Operon      
Name: intD         
Operon arrangement:
Transcription unit        Promoter
intD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_682 566013 reverse nd [RS-EPT-CBR] [1]
  promoter intDp6 566101 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB