RegulonDB RegulonDB 10.8: Gene Form
   

katE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

katE chbG cedA Fis terminator anti-terminator katEp katEp cedAp cedAp

Gene      
Name: katE    Texpresso search in the literature
Synonym(s): ECK1730, EG10509, b1732
Genome position(nucleotides): 1813867 --> 1816128 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.08
External database links:  
ASAP:
ABE-0005780
CGSC:
593
ECHOBASE:
EB0504
MIM:
614097
OU-MICROARRAY:
b1732
PortEco:
katE
STRING:
511145.b1732
COLOMBOS: katE


Product      
Name: catalase HPII
Synonym(s): KatE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 84.162
Isoelectric point: 5.728
Motif(s):
 
Type Positions Sequence
599 -> 746 KGRVVAILLNDEVRSADLLAILKALKAKGVHAKLLYSRMGEVTADDGTVLPIAATFAGAPSLTVDAVIVPCGNIADIADNGDANYYLMEAYKHLKPIALAGDARKFKATIKIADQGEEGIVEADSADGSFMDELLTLMAAHRVWSRIP
81 -> 466 TTNQGVRIADDQNSLRAGSRGPTLLEDFILREKITHFDHERIPERIVHARGSAAHGYFQPYKSLSDITKADFLSDPNKITPVFVRFSTVQGGAGSADTVRDIRGFATKFYTEEGIFDLVGNNTPIFFIQDAHKFPDFVHAVKPEPHWAIPQGQSAHDTFWDYVSLQPETLHNVMWAMSDRGIPRSYRTMEGFGIHTFRLINAEGKATFVRFHWKPLAGKASLVWDEAQKLTGRDPDFHRRELWEAIEAGDFPEYELGFQLIPEEDEFKFDFDLLDPTKLIPEELVPVQRVGKMVLNRNPDNFFAENEQAAFHPGHIVPGLDFTNDPLLQGRLFSYTDTQISRLGGPNFHEIPINRPTCPYHNFQRDGMHRMGIDTNPANYEPNSIN
499 -> 562 PSFGEYYSHPRLFWLSQTPFEQRHIVDGFSFELSKVVRPYIRERVVDQLAHIDLTLAQAVAKNL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004601 - peroxidase activity
GO:0004096 - catalase activity
GO:0005506 - iron ion binding
GO:0020037 - heme binding
GO:0042802 - identical protein binding
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0006979 - response to oxidative stress
GO:0006972 - hyperosmotic response
GO:0042744 - hydrogen peroxide catabolic process
GO:0055114 - oxidation-reduction process
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
Reference(s): [1] Benov L., et al., 2003
[2] Hoerter JD., et al., 2005
[3] Jung IL., et al., 2003
[4] Loewen PC., et al., 1984
[5] Mulvey MR., et al., 1988
[6] Mulvey MR., et al., 1990
[7] Oktyabrsky ON., et al., 2001
[8] Park C., et al., 2007
[9] Peng Q., et al., 1992
[10] Schellhorn HE., et al., 1992
[11] Semchyshyn HM., et al., null
[12] Semchyshyn HM., et al., null
[13] Smirnova GV., et al., 2000
[14] Smirnova GV., et al., null
External database links:  
DIP:
DIP-10052N
ECOCYC:
HYDROPEROXIDII-MONOMER
ECOLIWIKI:
b1732
INTERPRO:
IPR024708
INTERPRO:
IPR020835
INTERPRO:
IPR018028
INTERPRO:
IPR011614
INTERPRO:
IPR010582
INTERPRO:
IPR002226
INTERPRO:
IPR024712
INTERPRO:
IPR029062
INTERPRO:
IPR041399
INTERPRO:
IPR037060
MINT:
MINT-1247982
MODBASE:
P21179
PANTHER:
PTHR42821
PDB:
3P9Q
PDB:
3P9R
PDB:
3P9S
PDB:
3PQ2
PDB:
3PQ3
PDB:
3PQ4
PDB:
3PQ5
PDB:
3PQ6
PDB:
3PQ7
PDB:
3PQ8
PDB:
3TTU
PDB:
3TTV
PDB:
3TTW
PDB:
3TTX
PDB:
3VU3
PDB:
4BFL
PDB:
4ENP
PDB:
4ENQ
PDB:
4ENR
PDB:
4ENS
PDB:
4ENT
PDB:
4ENU
PDB:
4ENV
PDB:
4ENW
PDB:
5BV2
PDB:
6BY0
PDB:
3P9P
PDB:
1YE9
PDB:
1QWS
PDB:
1QF7
PDB:
1P81
PDB:
1P80
PDB:
1P7Z
PDB:
1P7Y
PDB:
1IPH
PDB:
1GGK
PDB:
1GGJ
PDB:
1GGH
PDB:
1GGF
PDB:
1GGE
PDB:
1GG9
PDB:
1CF9
PDB:
3TTT
PFAM:
PF06628
PFAM:
PF18011
PFAM:
PF00199
PRIDE:
P21179
PRINTS:
PR00067
PRODB:
PRO_000023042
PROSITE:
PS00438
PROSITE:
PS51402
PROSITE:
PS00437
REFSEQ:
YP_025308
SMART:
SM01060
SMR:
P21179
UNIPROT:
P21179


Operon      
Name: katE         
Operon arrangement:
Transcription unit        Promoter
katE


Transcriptional Regulation      
Display Regulation             
Activated by: Fur
Repressed by: Fis
Growth Conditions:

[1] 

C: Escherichia coli| minimal medium| casamino acids 0.2%; glucose 0.4%; thiamine 0.2 g/mL| oxygen atom| exponential phase
E: Escherichia coli| minimal medium| casamino acids 0.2%; glucose 0.4%; thiamine 0.2 g/mL| exponential phase

[2] 

C: Escherichia coli| minimal medium| casamino acids 0.2%; glucose 0.4%; thiamine 0.2 g/mL
E: Escherichia coli| rpoS knockout mutant| minimal medium| casamino acids 0.2%; glucose 0.4%; thiamine 0.2 g/mL

[3] 

C: Escherichia coli| minimal medium| casamino acids 0.2%; glucose 0.4%; thiamine 0.2 g/mL| oxygen atom
E: Escherichia coli| rpoS knockout mutant| minimal medium| casamino acids 0.2%; glucose 0.4%; thiamine 0.2 g/mL| oxygen atom

[4] 

C: Escherichia coli| minimal medium| casamino acids 0.2%; glucose 0.4%; thiamine 0.2 g/mL| oxygen atom| exponential phase
E: Escherichia coli| minimal medium| casamino acids 0.2%; glucose 0.4%; thiamine 0.2 g/mL| oxygen atom| stationary phase



RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Benov L., Sequeira F., 2003, Escherichia coli deltafur mutant displays low HPII catalase activity in stationary phase., Redox Rep 8(6):379-83

 [2] Hoerter JD., Arnold AA., Kuczynska DA., Shibuya A., Ward CS., Sauer MG., Gizachew A., Hotchkiss TM., Fleming TJ., Johnson S., 2005, Effects of sublethal UVA irradiation on activity levels of oxidative defense enzymes and protein oxidation in Escherichia coli., J Photochem Photobiol B 81(3):171-80

 [3] Jung IL., Kim IG., 2003, Transcription of ahpC, katG, and katE genes in Escherichia coli is regulated by polyamines: polyamine-deficient mutant sensitive to H2O2-induced oxidative damage., Biochem Biophys Res Commun 301(4):915-22

 [4] Loewen PC., Triggs BL., 1984, Genetic mapping of katF, a locus that with katE affects the synthesis of a second catalase species in Escherichia coli., J Bacteriol 160(2):668-75

 [5] Mulvey MR., Sorby PA., Triggs-Raine BL., Loewen PC., 1988, Cloning and physical characterization of katE and katF required for catalase HPII expression in Escherichia coli., Gene 73(2):337-45

 [6] Mulvey MR., Switala J., Borys A., Loewen PC., 1990, Regulation of transcription of katE and katF in Escherichia coli., J Bacteriol 172(12):6713-20

 [7] Oktyabrsky ON., Smirnovam GV., Muzyka NG., 2001, Role of glutathione in regulation of hydroperoxidase I in growing Escherichia coli., Free Radic Biol Med 31(2):250-5

 [8] Park C., Zhou S., Gilmore J., Marqusee S., 2007, Energetics-based protein profiling on a proteomic scale: identification of proteins resistant to proteolysis., J Mol Biol 368(5):1426-37

 [9] Peng Q., Timkovich R., Loewen PC., Peterson J., 1992, Identification of heme macrocycle type by near-infrared magnetic circular dichroism spectroscopy at cryogenic temperatures., FEBS Lett 309(2):157-60

 [10] Schellhorn HE., Stones VL., 1992, Regulation of katF and katE in Escherichia coli K-12 by weak acids., J Bacteriol 174(14):4769-76

 [11] Semchyshyn HM., Dyl'ovyi MV., Lushchak VI., null, [pH-dependency of Escherichia coli catalase activity under modified culture conditions]., Ukr Biokhim Zh 74(5):34-41

 [12] Semchyshyn HM., Lushchak VI., null, [Oxidative stress and control of catalase activity in Escherichia coli]., Ukr Biokhim Zh 76(2):31-42

 [13] Smirnova GV., Muzyka NG., Oktyabrsky ON., 2000, The role of antioxidant enzymes in response of Escherichia coli to osmotic upshift., FEMS Microbiol Lett 186(2):209-13

 [14] Smirnova GV., Zakirova ON., Oktiabr'skii ON., null, [The role of antioxidant systems in response of bacteria Escherichia coli to heat shock]., Mikrobiologiia 70(5):595-601


RegulonDB