RegulonDB RegulonDB 10.8: Gene Form
   

kdpC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kdpD kdpB kdpE kdpC kdpEp3 kdpEp3 TSS_827 TSS_827

Gene      
Name: kdpC    Texpresso search in the literature
Synonym(s): ECK0684, EG10515, b0696, kac
Genome position(nucleotides): 724407 <-- 724979 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.58
External database links:  
ASAP:
ABE-0002374
CGSC:
586
ECHOBASE:
EB0510
OU-MICROARRAY:
b0696
PortEco:
kdpC
STRING:
511145.b0696
COLOMBOS: kdpC


Product      
Name: K+ transporting P-type ATPase subunit KdpC
Synonym(s): Kac, KdpC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 20.267
Isoelectric point: 7.512
Motif(s):
 
Type Positions Sequence
10 -> 30 TFIFLLLITGGVYPLLTTVLG
140 -> 150 QIPRVAKARNL
5 -> 187 RPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIREGDTVRGSALIGQNFTGNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAALRAANPDASASVPVELVTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVELNLALDK

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.3 - The P-type ATPase (P-ATPase) Superfamily
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0031004 - potassium ion-transporting ATPase complex
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008556 - potassium transmembrane transporter activity, phosphorylative mechanism
biological_process GO:0006811 - ion transport
GO:0006813 - potassium ion transport
GO:0071805 - potassium ion transmembrane transport
GO:0098655 - cation transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Ahnert F., et al., 2006
[2] Buurman ET., et al., 1995
[3] Gassel M., et al., 2001
[4] Gassel M., et al., 1998
External database links:  
ECOCYC:
EG10515-MONOMER
ECOLIWIKI:
b0696
INTERPRO:
IPR003820
MINT:
P03961
PANTHER:
PTHR30042
PDB:
6HRA
PDB:
5MRW
PDB:
6HRB
PFAM:
PF02669
PRIDE:
P03961
REFSEQ:
NP_415224
SMR:
P03961
UNIPROT:
P03961


Operon      
Name: kdpFABC         
Operon arrangement:
Transcription unit        Promoter
kdpFABC


Transcriptional Regulation      
Display Regulation             
Activated by: KdpE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_827 721772 reverse nd [RS-EPT-CBR] [5]
  promoter kdpEp3 721894 reverse Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Ahnert F., Schmid R., Altendorf K., Greie JC., 2006, ATP binding properties of the soluble part of the KdpC subunit from the Escherichia coli K(+)-transporting KdpFABC P-type ATPase., Biochemistry 45(36):11038-46

 [2] Buurman ET., Kim KT., Epstein W., 1995, Genetic evidence for two sequentially occupied K+ binding sites in the Kdp transport ATPase., J Biol Chem 270(12):6678-85

 [3] Gassel M., Altendorf K., 2001, Analysis of KdpC of the K(+)-transporting KdpFABC complex of Escherichia coli., Eur J Biochem 268(6):1772-81

 [4] Gassel M., Siebers A., Epstein W., Altendorf K., 1998, Assembly of the Kdp complex, the multi-subunit K+-transport ATPase of Escherichia coli., Biochim Biophys Acta 1415(1):77-84

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB