RegulonDB RegulonDB 10.7: Gene Form
   

kdpD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kdpD kdpB kdpE kdpC ybfK kdpEp3 kdpEp3 TSS_827 TSS_827

Gene      
Name: kdpD    Texpresso search in the literature
Synonym(s): ECK0683, EG10516, b0695, kac
Genome position(nucleotides): 721730 <-- 724414 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.58
External database links:  
ASAP:
ABE-0002368
CGSC:
585
ECHOBASE:
EB0511
OU-MICROARRAY:
b0695
PORTECO:
kdpD
REGULONDB:
b0695
STRING:
511145.b0695
M3D: kdpD
COLOMBOS: kdpD
PortEco: b0695


Product      
Name: sensory histidine kinase KdpD
Synonym(s): Kac, KdpD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 98.718
Isoelectric point: 6.561
Motif(s):
 
Type Positions Sequence
463 -> 473 FIAPRGTLAVS
665 -> 730 NALLAALSHDLRTPLTVLFGQAEILTLDLASEGSPHARQASEIRQHVLNTTRLVNNLLDMARIQSG
670 -> 883 ALSHDLRTPLTVLFGQAEILTLDLASEGSPHARQASEIRQHVLNTTRLVNNLLDMARIQSGGFNLKKEWLTLEEVVGSALQMLEPGLSSPINLSLPEPLTLIHVDGPLFERVLINLLENAVKYAGAQAEIGIDAHVEGENLQLDVWDNGPGLPPGQEQTIFDKFARGNKESAVPGVGLGLAICRAIVDVHGGTITAFNRPEGGACFRVTLPQQT
682 -> 682 L
707 -> 707 I

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0008134 - transcription factor binding
GO:0016791 - phosphatase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0071472 - cellular response to salt stress
GO:0016311 - dephosphorylation
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0009593 - detection of chemical stimulus
GO:0046777 - protein autophosphorylation
GO:0031668 - cellular response to extracellular stimulus
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
External database links:  
DIP:
DIP-10062N
ECOCYC:
KDPD-MONOMER
ECOLIWIKI:
b0695
INTERPRO:
IPR029016
INTERPRO:
IPR036890
INTERPRO:
IPR036097
INTERPRO:
IPR038318
INTERPRO:
IPR003018
INTERPRO:
IPR003594
INTERPRO:
IPR003661
INTERPRO:
IPR003852
INTERPRO:
IPR004358
INTERPRO:
IPR005467
INTERPRO:
IPR025201
MODBASE:
P21865
PDB:
4Y2F
PDB:
4QPR
PDB:
2KSF
PFAM:
PF13493
PFAM:
PF13492
PFAM:
PF02702
PFAM:
PF02518
PFAM:
PF00512
PRIDE:
P21865
PRINTS:
PR00344
PRODB:
PRO_000023052
PROSITE:
PS50109
PROTEINMODELPORTAL:
P21865
REFSEQ:
NP_415223
SMART:
SM00387
SMART:
SM00388
SMR:
P21865
UNIPROT:
P21865


Operon      
Name: kdpDE         
Operon arrangement:
Transcription unit        Promoter
kdpDE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_827 721772 reverse nd [RS-EPT-CBR] [1]
  promoter kdpEp3 721894 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB