RegulonDB RegulonDB 10.7: Gene Form
   

kdpE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kdpD kdpE kdpC ybfK kdpEp3 kdpEp3 TSS_827 TSS_827

Gene      
Name: kdpE    Texpresso search in the literature
Synonym(s): ECK0682, EG10517, b0694
Genome position(nucleotides): 721056 <-- 721733 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.64
External database links:  
ASAP:
ABE-0002366
CGSC:
31571
ECHOBASE:
EB0512
OU-MICROARRAY:
b0694
PORTECO:
kdpE
REGULONDB:
b0694
STRING:
511145.b0694
M3D: kdpE
COLOMBOS: kdpE
PortEco: b0694


Product      
Name: DNA-binding transcriptional activator KdpE
Synonym(s): KdpE, KdpE response regulator, KdpE transcriptional activator
Sequence: Get amino acid sequence Fasta Format
Regulator Family: OmpR
Cellular location: cytosol
Molecular weight: 25.362
Isoelectric point: 6.402
Motif(s):
 
Type Positions Sequence
4 -> 112 VLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARL
148 -> 223 EEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPARPRHFITETGIGYRF
160 -> 176 LAVLLNNAGKVLTQRQL
3 -> 116 NVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVAL
126 -> 225 DPLVKFSDVTVDLAARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPARPRHFITETGIGYRFML

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000156 - phosphorelay response regulator activity
GO:0042803 - protein homodimerization activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
Reference(s): [1] Pao GM., et al., 1995
[2] Parkinson JS. 1993
[3] Parkinson JS., et al., 1992
[4] Stock JB., et al., 1990
[5] Walderhaug MO., et al., 1992
External database links:  
DIP:
DIP-10063N
ECOCYC:
KDPE-MONOMER
ECOLIWIKI:
b0694
INTERPRO:
IPR001789
INTERPRO:
IPR001867
INTERPRO:
IPR011006
INTERPRO:
IPR036388
INTERPRO:
IPR039420
MODBASE:
P21866
PANTHER:
PTHR26402
PDB:
4L85
PDB:
4KNY
PDB:
4KFC
PDB:
3ZQ7
PDB:
1ZH4
PDB:
1ZH2
PFAM:
PF00486
PFAM:
PF00072
PRIDE:
P21866
PRODB:
PRO_000023053
PROSITE:
PS51755
PROSITE:
PS50110
PROTEINMODELPORTAL:
P21866
REFSEQ:
NP_415222
SMART:
SM00448
SMART:
SM00862
SMR:
P21866
SWISSMODEL:
P21866
UNIPROT:
P21866


Operon      
Name: kdpDE         
Operon arrangement:
Transcription unit        Promoter
kdpDE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_827 721772 reverse nd [RS-EPT-CBR] [6]
  promoter kdpEp3 721894 reverse Similarity to the consensus
Read more >
[ICWHO] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Pao GM., Saier MH., 1995, Response regulators of bacterial signal transduction systems: selective domain shuffling during evolution., J Mol Evol 40(2):136-54

 [2] Parkinson JS., 1993, Signal transduction schemes of bacteria., Cell 73(5):857-71

 [3] Parkinson JS., Kofoid EC., 1992, Communication modules in bacterial signaling proteins., Annu Rev Genet 26:71-112

 [4] Stock JB., Stock AM., Mottonen JM., 1990, Signal transduction in bacteria., Nature 344(6265):395-400

 [5] Walderhaug MO., Polarek JW., Voelkner P., Daniel JM., Hesse JE., Altendorf K., Epstein W., 1992, KdpD and KdpE, proteins that control expression of the kdpABC operon, are members of the two-component sensor-effector class of regulators., J Bacteriol 174(7):2152-9

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB