RegulonDB RegulonDB 10.8: Gene Form
   

kgtP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pssA kgtP yfiM yfiS pssL TSS_2901 TSS_2901 kgtPp8 kgtPp8 kgtPp6 kgtPp6 kgtPp7 kgtPp7 TSS_2900 TSS_2900 TSS_2899 TSS_2899 TSS_2898 (cluster) TSS_2898 (cluster) yfiMp2 yfiMp2 TSS_2897 TSS_2897

Gene      
Name: kgtP    Texpresso search in the literature
Synonym(s): ECK2585, EG10522, b2587, witA
Genome position(nucleotides): 2724448 <-- 2725746 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.73
External database links:  
ASAP:
ABE-0008515
CGSC:
32867
ECHOBASE:
EB0517
OU-MICROARRAY:
b2587
PortEco:
kgtP
STRING:
511145.b2587
COLOMBOS: kgtP


Product      
Name: α-ketoglutarate:H+ symporter
Synonym(s): alpha;-ketoglutarate MFS transporter, KgtP, WitA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 47.052
Isoelectric point: 9.692
Motif(s):
 
Type Positions Sequence
403 -> 423 TAFFWYVTLMAVVAFLVSLML
194 -> 214 EWGWRIPFALGAVLAVVALWL
163 -> 183 SFQYVTLIGGQLLALLVVVVL
223 -> 421 QQETRALKEAGSLKGLWRNRRAFIMVLGFTAAGSLCFYTFTTYMQKYLVNTAGMHANVASGIMTAALFVFMLIQPLIGALSDKIGRRTSMLCFGSLAAIFTVPILSALQNVSSPYAAFGLVMCALLIVSFYTSISGILKAEMFPAQVRALGVGLSYAVANAIFGGSAEYVALSLKSIGMETAFFWYVTLMAVVAFLVSL
63 -> 83 LQTAGVFAAGFLMRPIGGWLF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015293 - symporter activity
GO:0015294 - solute:cation symporter activity
GO:0022857 - transmembrane transporter activity
biological_process GO:0034220 - ion transmembrane transport
GO:0055085 - transmembrane transport
GO:0098655 - cation transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
KGTP-MONOMER
ECOLIWIKI:
b2587
INTERPRO:
IPR005828
INTERPRO:
IPR036259
INTERPRO:
IPR020846
INTERPRO:
IPR005829
INTERPRO:
IPR004736
MODBASE:
P0AEX3
PFAM:
PF00083
PRIDE:
P0AEX3
PRODB:
PRO_000023065
PROSITE:
PS50850
PROSITE:
PS00217
PROSITE:
PS00216
REFSEQ:
NP_417082
SMR:
P0AEX3
UNIPROT:
P0AEX3


Operon      
Name: kgtP         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2897 2723828 forward nd [RS-EPT-CBR] [1]
  promoter yfiMp2 2724033 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2898 (cluster) 2724586 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2899 2724730 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2900 2725342 reverse nd [RS-EPT-CBR] [1]
  promoter kgtPp7 2725760 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter kgtPp6 2725809 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter kgtPp8 2725812 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2901 2725834 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB