RegulonDB RegulonDB 10.6.3: Gene Form
   

lacA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lacY cynX lacA

Gene      
Name: lacA    Texpresso search in the literature
Synonym(s): ECK0339, EG10524, b0342
Genome position(nucleotides): 361249 <-- 361860 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.81
Reference(s): [1] Hediger MA., et al., 1985
External database links:  
ASAP:
ABE-0001177
CGSC:
579
ECHOBASE:
EB0519
ECOCYC:
EG10524
ECOLIHUB:
lacA
OU-MICROARRAY:
b0342
REGULONDB:
b0342
STRING:
511145.b0342
M3D: lacA
COLOMBOS: lacA
PortEco: b0342


Product      
Name: galactoside O-acetyltransferase
Synonym(s): LacA, thiogalactoside acetyltransferase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.799
Isoelectric point: 6.722
Motif(s):
 
Type Positions Sequence
96 -> 110 VTIGDNVLIAPNVTL
132 -> 166 ITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTK
9 -> 59 IRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVEKRESLIKEMFATVG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016407 - acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0008870 - galactoside O-acetyltransferase activity
GO:0042802 - identical protein binding
biological_process GO:0005989 - lactose biosynthetic process
External database links:  
DIP:
DIP-10078N
ECOCYC:
GALACTOACETYLTRAN-MONOMER
ECOLIWIKI:
b0342
INTERPRO:
IPR018357
INTERPRO:
IPR039369
INTERPRO:
IPR024688
INTERPRO:
IPR011004
INTERPRO:
IPR001451
MODBASE:
P07464
PANTHER:
PTHR43017
PDB:
1KRU
PDB:
1KQA
PDB:
1KRR
PDB:
1KRV
PFAM:
PF14602
PFAM:
PF00132
PFAM:
PF12464
PRIDE:
P07464
PRODB:
PRO_000023069
PROSITE:
PS00101
PROTEINMODELPORTAL:
P07464
REFSEQ:
NP_414876
SMART:
SM01266
SMR:
P07464
UNIPROT:
P07464


Operon      
Name: lacZYA         
Operon arrangement:
Transcription unit        Promoter
lacZYA
lacZYA
lacZYA
lacZYA
lacYA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: LacI, CRP, H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Hediger MA., Johnson DF., Nierlich DP., Zabin I., 1985, DNA sequence of the lactose operon: the lacA gene and the transcriptional termination region., Proc Natl Acad Sci U S A 82(19):6414-8


RegulonDB