RegulonDB RegulonDB 10.8: Gene Form
   

lacZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lacZ lacY lacI LacI H-NS CRP H-NS H-NS MarA H-NS H-NS LacI CRP H-NS LacI terminator lacZp4 lacZp4 lacZp2 lacZp2 lacZp3 lacZp3 lacZp1 lacZp1

Gene      
Name: lacZ    Texpresso search in the literature
Synonym(s): ECK0341, EG10527, b0344
Genome position(nucleotides): 363231 <-- 366305 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.26
External database links:  
ASAP:
ABE-0001183
CGSC:
576
ECHOBASE:
EB0522
OU-MICROARRAY:
b0344
PortEco:
lacZ
STRING:
511145.b0344
COLOMBOS: lacZ


Product      
Name: β-galactosidase
Synonym(s): LacZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 116.483
Isoelectric point: 5.207
Motif(s):
 
Type Positions Sequence
222 -> 334 QISDFHVATRFNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLRLNVENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGFR
358 -> 358 H
52 -> 219 LRSLNGEWRFAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKP
1000 -> 1000 W
637 -> 723 IEVTSEYLFRHSDNELLHWMVALDGKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHISAWQQWRL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009341 - beta-galactosidase complex
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0004565 - beta-galactosidase activity
GO:0030246 - carbohydrate binding
GO:0000287 - magnesium ion binding
GO:0031420 - alkali metal ion binding
GO:0042802 - identical protein binding
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0005990 - lactose catabolic process
External database links:  
CAZY:
GH2
DIP:
DIP-10081N
ECOCYC:
BETAGALACTOSID-MONOMER
ECOLIWIKI:
b0344
INTERPRO:
IPR004199
INTERPRO:
IPR036156
INTERPRO:
IPR006102
INTERPRO:
IPR006103
INTERPRO:
IPR006104
INTERPRO:
IPR008979
INTERPRO:
IPR011013
INTERPRO:
IPR013783
INTERPRO:
IPR014718
INTERPRO:
IPR017853
INTERPRO:
IPR023230
INTERPRO:
IPR023232
INTERPRO:
IPR023933
INTERPRO:
IPR032312
INTERPRO:
IPR006101
MODBASE:
P00722
PANTHER:
PTHR46323
PDB:
1F4H
PDB:
1HN1
PDB:
1JYN
PDB:
1JYV
PDB:
1JYW
PDB:
1JYX
PDB:
1JZ2
PDB:
1JZ3
PDB:
1JZ4
PDB:
1JZ5
PDB:
1JZ6
PDB:
1JZ7
PDB:
1JZ8
PDB:
1PX3
PDB:
1PX4
PDB:
3CZJ
PDB:
3DYM
PDB:
3DYO
PDB:
3DYP
PDB:
3E1F
PDB:
3I3B
PDB:
3I3D
PDB:
3I3E
PDB:
3IAP
PDB:
3IAQ
PDB:
3J7H
PDB:
3MUY
PDB:
3MUZ
PDB:
3MV0
PDB:
3MV1
PDB:
3SEP
PDB:
3T08
PDB:
3T09
PDB:
3T0A
PDB:
3T0B
PDB:
3T0D
PDB:
3T2O
PDB:
3T2P
PDB:
3T2Q
PDB:
3VD3
PDB:
3VD4
PDB:
3VD5
PDB:
3VD7
PDB:
3VD9
PDB:
3VDA
PDB:
3VDB
PDB:
3VDC
PDB:
4CKD
PDB:
4DUV
PDB:
4DUW
PDB:
4DUX
PDB:
4TTG
PDB:
4V40
PDB:
4V41
PDB:
4V44
PDB:
4V45
PDB:
5A1A
PDB:
6CVM
PDB:
6DRV
PDB:
1DP0
PDB:
1F4A
PFAM:
PF02836
PFAM:
PF02837
PFAM:
PF02929
PFAM:
PF16353
PFAM:
PF00703
PRIDE:
P00722
PRINTS:
PR00132
PROSITE:
PS00608
PROSITE:
PS00719
REFSEQ:
NP_414878
SMART:
SM01038
SMR:
P00722
UNIPROT:
P00722


Operon      
Name: lacZYA         
Operon arrangement:
Transcription unit        Promoter
lacZYA
lacZYA
lacZYA
lacZYA
lacYA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: LacI, MarA, CRP, H-NS


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB