RegulonDB RegulonDB 10.8: Gene Form
   

leuO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

leuO leuL yabR Lrp Lrp Lrp Lrp RcsB-BglJ LeuO LeuO H-NS SlyA SlyA LeuO LeuO LrhA ppGpp ppGpp ppGpp Cis-reg; leader terminator anti-terminator anti-anti-terminator anti-anti-terminator anti-terminator ilvIp3 ilvIp3 ilvIp4 ilvIp4 leuOp2 leuOp2 leuOp3 leuOp3 leuOp leuOp leuOp1 leuOp1 leuLp2 leuLp2 leuLp leuLp TSS_146 TSS_146

Gene      
Name: leuO    Texpresso search in the literature
Synonym(s): ECK0078, EG10531, b0076
Genome position(nucleotides): 84368 --> 85312 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.71
External database links:  
ASAP:
ABE-0000280
CGSC:
35918
ECHOBASE:
EB0526
OU-MICROARRAY:
b0076
PortEco:
leuO
STRING:
511145.b0076
COLOMBOS: leuO


Product      
Name: DNA-binding transcriptional dual regulator LeuO
Synonym(s): LeuO
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 35.695
Isoelectric point: 6.186
Motif(s):
 
Type Positions Sequence
39 -> 58 ITRAAHVLGMSQPAVSNAVA
291 -> 314 WHEAAGRDKGHQWMEEQLVSICKR
137 -> 309 IAPNIHVMFKSSLNQNTEHQLRYQETEFVISYEDFHRPEFTSVPLFKDEMVLVASKNHPTIKGPLLKHDVYNEQHAAVSLDRFASFSQPWYDTVDKQASIAYQGMAMMSVLSVVSQTHLVAIAPRWLAEEFAESLELQVLPLPLKQNSRTCYLSWHEAAGRDKGHQWMEEQLV
22 -> 79 VDLNLLTVFDAVMQEQNITRAAHVLGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPT
24 -> 81 LNLLTVFDAVMQEQNITRAAHVLGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTAR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.19 - leucine
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[GEA] Gene expression analysis
[IE] Inferred from experiment
Reference(s): [1] Chen CC., et al., 2005
[2] Chen CC., et al., 2001
[3] Haughn GW., et al., 1986
[4] Henikoff S., et al., 1988
[5] Madhusudan S., et al., 2005
[6] Shi X., et al., 1995
[7] Ueguchi C., et al., 1998
[8] Yura T., et al., 1992
External database links:  
ECOCYC:
PD00519
ECOLIWIKI:
b0076
INTERPRO:
IPR000847
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR005119
MODBASE:
P10151
PDB:
6GZ2
PDB:
6GZ0
PDB:
6GZ1
PFAM:
PF03466
PFAM:
PF00126
PRIDE:
P10151
PRINTS:
PR00039
PROSITE:
PS50931
REFSEQ:
NP_414618
SMR:
P10151
UNIPROT:
P10151


Operon      
Name: leuO         
Operon arrangement:
Transcription unit        Promoter
leuO
leuO
leuO
leuO


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA, LeuO, LrhA, RcsB-BglJ
Repressed by: LeuO, H-NS, StpA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_146 83728 reverse nd [RS-EPT-CBR] [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chen CC., Chou MY., Huang CH., Majumder A., Wu HY., 2005, A cis-spreading nucleoprotein filament is responsible for the gene silencing activity found in the promoter relay mechanism., J Biol Chem 280(6):5101-12

 [2] Chen CC., Fang M., Majumder A., Wu HY., 2001, A 72-base pair AT-rich DNA sequence element functions as a bacterial gene silencer., J Biol Chem 276(12):9478-85

 [3] Haughn GW., Wessler SR., Gemmill RM., Calvo JM., 1986, High A + T content conserved in DNA sequences upstream of leuABCD in Escherichia coli and Salmonella typhimurium., J Bacteriol 166(3):1113-7

 [4] Henikoff S., Haughn GW., Calvo JM., Wallace JC., 1988, A large family of bacterial activator proteins., Proc Natl Acad Sci U S A 85(18):6602-6

 [5] Madhusudan S., Paukner A., Klingen Y., Schnetz K., 2005, Independent regulation of H-NS-mediated silencing of the bgl operon at two levels: upstream by BglJ and LeuO and downstream by DnaKJ., Microbiology 151(Pt 10):3349-59

 [6] Shi X., Bennett GN., 1995, Effects of multicopy LeuO on the expression of the acid-inducible lysine decarboxylase gene in Escherichia coli., J Bacteriol 177(3):810-4

 [7] Ueguchi C., Ohta T., Seto C., Suzuki T., Mizuno T., 1998, The leuO gene product has a latent ability to relieve bgl silencing in Escherichia coli., J Bacteriol 180(1):190-3

 [8] Yura T., Mori H., Nagai H., Nagata T., Ishihama A., Fujita N., Isono K., Mizobuchi K., Nakata A., 1992, Systematic sequencing of the Escherichia coli genome: analysis of the 0-2.4 min region., Nucleic Acids Res 20(13):3305-8

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB