RegulonDB RegulonDB 10.8: Gene Form
   

lexA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dinF lexA dgkA LexA LexA LexA anti-terminator terminator TSS_4882 TSS_4882 lexAp lexAp

Gene      
Name: lexA    Texpresso search in the literature
Synonym(s): ECK4035, EG10533, b4043, exrA, spr, tsl, umuA
Genome position(nucleotides): 4257115 --> 4257723 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.89
External database links:  
ASAP:
ABE-0013241
CGSC:
558
ECHOBASE:
EB0528
OU-MICROARRAY:
b4043
PortEco:
lexA
STRING:
511145.b4043
COLOMBOS: lexA


Product      
Name: DNA-binding transcriptional repressor LexA
Synonym(s): ExrA, LexA, Spr, Tsl, UmuA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LexA
Cellular location: cytosol
Molecular weight: 22.358
Isoelectric point: 6.693
Motif(s):
 
Type Positions Sequence
114 -> 180 RVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVD
85 -> 85 G
1 -> 65 MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRG
28 -> 48 RAEIAQRLGFRSPNAAEEHLK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
  5 - cell processes --> 5.8 - SOS response
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
GO:0035327 - transcriptionally active chromatin
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0004252 - serine-type endopeptidase activity
GO:0042802 - identical protein binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
biological_process GO:0006260 - DNA replication
GO:0006281 - DNA repair
GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0006508 - proteolysis
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
GO:0045892 - negative regulation of transcription, DNA-templated
Reference(s): [1] Blattner FR., et al., 1993
[2] Brent R., et al., 1981
[3] Fogh RH., et al., 1994
[4] Horii T., et al., 1981
[5] Lamerichs RM., et al., 1989
[6] Little JW., et al., 1981
[7] Markham BE., et al., 1981
[8] Miki T., et al., 1981
External database links:  
DIP:
DIP-51082N
ECOCYC:
PD00205
ECOLIWIKI:
b4043
INTERPRO:
IPR015927
INTERPRO:
IPR006200
INTERPRO:
IPR006199
INTERPRO:
IPR006197
INTERPRO:
IPR036286
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR039418
MINT:
MINT-1314348
MODBASE:
P0A7C2
PDB:
3K3R
PDB:
3JSP
PDB:
1QAA
PDB:
1MVD
PDB:
1LEB
PDB:
1LEA
PDB:
1JHH
PDB:
1JHF
PDB:
1JHE
PDB:
1JHC
PDB:
3JSO
PFAM:
PF00717
PFAM:
PF01726
PRIDE:
P0A7C2
PRINTS:
PR00726
PRODB:
PRO_000023087
REFSEQ:
NP_418467
SMR:
P0A7C2
UNIPROT:
P0A7C2


Operon      
Name: lexA-dinF         
Operon arrangement:
Transcription unit        Promoter
lexA-dinF


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4882 4257204 forward nd [RS-EPT-CBR] [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Blattner FR., Burland V., Plunkett G., Sofia HJ., Daniels DL., 1993, Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes., Nucleic Acids Res 21(23):5408-17

 [2] Brent R., Ptashne M., 1981, Mechanism of action of the lexA gene product., Proc Natl Acad Sci U S A 78(7):4204-8

 [3] Fogh RH., Ottleben G., Ruterjans H., Schnarr M., Boelens R., Kaptein R., 1994, Solution structure of the LexA repressor DNA binding domain determined by 1H NMR spectroscopy., EMBO J 13(17):3936-44

 [4] Horii T., Ogawa T., Ogawa H., 1981, Nucleotide sequence of the lexA gene of E. coli., Cell 23(3):689-97

 [5] Lamerichs RM., Padilla A., Boelens R., Kaptein R., Ottleben G., Ruterjans H., Granger-Schnarr M., Oertel P., Schnarr M., 1989, The amino-terminal domain of LexA repressor is alpha-helical but differs from canonical helix-turn-helix proteins: a two-dimensional 1H NMR study., Proc Natl Acad Sci U S A 86(18):6863-7

 [6] Little JW., Mount DW., Yanisch-Perron CR., 1981, Purified lexA protein is a repressor of the recA and lexA genes., Proc Natl Acad Sci U S A 78(7):4199-203

 [7] Markham BE., Little JW., Mount DW., 1981, Nucleotide sequence of the lexA gene of Escherichia coli K-12., Nucleic Acids Res 9(16):4149-61

 [8] Miki T., Ebina Y., Kishi F., Nakazawa A., 1981, Organization of the lexA gene of Escherichia coli and nucleotide sequence of the regulatory region., Nucleic Acids Res 9(3):529-43

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB