RegulonDB RegulonDB 10.7: Gene Form
   

lon gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lon hupB sraA CpxR CpxR CpxR Fis CRP Fis Fis Fis anti-anti-terminator terminator terminator anti-terminator TSS_605 TSS_605 TSS_604 (cluster) TSS_604 (cluster) TSS_603 TSS_603 TSS_602 TSS_602 TSS_601 TSS_601 TSS_600 TSS_600 TSS_599 TSS_599 hupBp1 hupBp1 TSS_598 TSS_598 TSS_597 (cluster) TSS_597 (cluster) TSS_596 (cluster) TSS_596 (cluster) TSS_595 (cluster) TSS_595 (cluster) hupBp2 hupBp2 TSS_593 TSS_593 TSS_592 TSS_592 hupBp3 hupBp3 hupBp4 hupBp4 TSS_590 TSS_590 TSS_589 TSS_589 lonp lonp TSS_587 TSS_587 TSS_586 TSS_586 TSS_585 TSS_585 TSS_584 TSS_584

Gene      
Name: lon    Texpresso search in the literature
Synonym(s): ECK0433, EG10542, b0439, capR, deg, dir, lopA, muc
Genome position(nucleotides): 458888 --> 461242 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.31
External database links:  
ASAP:
ABE-0001521
CGSC:
547
ECHOBASE:
EB0537
MIM:
600373
OU-MICROARRAY:
b0439
PORTECO:
lon
REGULONDB:
b0439
STRING:
511145.b0439
M3D: lon
COLOMBOS: lon
PortEco: b0439


Product      
Name: Lon protease
Synonym(s): CapR, DNA-binding, ATP-dependent protease La, Deg, Dir, Lon, LopA, Muc
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 87.438
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
2 -> 784 NPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMDHDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVKVLVEGLQRARISALSDNGEHFSAKAEYLESPTIDEREQEVLVRTAISQFEGYIKLNKKIPPEVLTSLNSIDDPARLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLLQVEKRIRNRVKKQMEKSQREYYLNEQMKAIQKELGEMDDAPDENEALKRKIDAAKMPKEAKEKAEAELQKLKMMSPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILDTDHYGLERVKDRILEYLAVQSRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYVRMALGGVRDEAEIRGHRRTYIGSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNVAFSDHYLEVDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIAKRHLLPKQIERNALKKGELTVDDSAIIGIIRYYTREAGVRGLEREISKLCRKAVKQLLLDKSLKHIEINGDNLHDYLGVQRFDYGRADNENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEPSGMQVVTAK
307 -> 307 S
539 -> 563 AGVRGLEREISKLCRKAVKQLLLDK
570 -> 772 INGDNLHDYLGVQRFDYGRADNENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQ
240 -> 252 ELGEMDDAPDENE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.4 - proteases, cleavage of compounds
  5 - cell processes --> 5.1 - cell division
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
  8 - extrachromosomal --> 8.2 - plasmid related
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004176 - ATP-dependent peptidase activity
GO:0004252 - serine-type endopeptidase activity
GO:0008236 - serine-type peptidase activity
GO:0043565 - sequence-specific DNA binding
GO:0042802 - identical protein binding
biological_process GO:0010165 - response to X-ray
GO:0006508 - proteolysis
GO:0006515 - protein quality control for misfolded or incompletely synthesized proteins
GO:0009408 - response to heat
GO:0030163 - protein catabolic process
GO:0034605 - cellular response to heat
Reference(s): [1] Sargentini NJ., et al., 2016
External database links:  
DIP:
DIP-35845N
ECOCYC:
EG10542-MONOMER
ECOLIWIKI:
b0439
ECOO157CYC:
LON-MONOMER
INTERPRO:
IPR027065
INTERPRO:
IPR027417
INTERPRO:
IPR020568
INTERPRO:
IPR027543
INTERPRO:
IPR015947
INTERPRO:
IPR014721
INTERPRO:
IPR003111
INTERPRO:
IPR003593
INTERPRO:
IPR003959
INTERPRO:
IPR004815
INTERPRO:
IPR008268
INTERPRO:
IPR008269
MINT:
P0A9M0
MODBASE:
P0A9M0
PANTHER:
PTHR10046
PDB:
3LJC
PDB:
2ANE
PDB:
1RRE
PDB:
1RR9
PDB:
1QZM
PFAM:
PF02190
PFAM:
PF05362
PFAM:
PF00004
PRIDE:
P0A9M0
PRODB:
PRO_000023108
PROSITE:
PS01046
PROSITE:
PS51786
PROSITE:
PS51787
PROTEINMODELPORTAL:
P0A9M0
REFSEQ:
NP_414973
SMART:
SM00464
SMART:
SM00382
SMR:
P0A9M0
UNIPROT:
P0A9M0


Operon      
Name: clpPX-lon         
Operon arrangement:
Transcription unit        Promoter
clpPX
clpPX
clpPX
clpX-lon
lon


Transcriptional Regulation      
Display Regulation             
Activated by: GadX


RNA cis-regulatory element    
Attenuation: Transcriptional


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_584 458768 forward nd [RS-EPT-CBR] [2]
  promoter TSS_585 458780 forward nd [RS-EPT-CBR] [2]
  promoter TSS_586 458803 forward nd [RS-EPT-CBR] [2]
  promoter TSS_587 458809 forward nd [RS-EPT-CBR] [2]
  promoter TSS_589 458867 forward nd [RS-EPT-CBR] [2]
  promoter TSS_590 458974 forward nd [RS-EPT-CBR] [2]
  promoter TSS_592 461391 forward nd [RS-EPT-CBR] [2]
  promoter TSS_593 461393 forward nd [RS-EPT-CBR] [2]
  promoter TSS_595 (cluster) 461430 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_596 (cluster) 461433 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_597 (cluster) 461436 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_598 461441 forward nd [RS-EPT-CBR] [2]
  promoter TSS_599 461445 forward nd [RS-EPT-CBR] [2]
  promoter TSS_600 461451 forward nd [RS-EPT-CBR] [2]
  promoter TSS_601 461455 forward nd [RS-EPT-CBR] [2]
  promoter TSS_602 461459 forward nd [RS-EPT-CBR] [2]
  promoter TSS_603 461478 forward nd [RS-EPT-CBR] [2]
  promoter TSS_604 (cluster) 461543 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_605 461552 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB