RegulonDB RegulonDB 10.10: Gene Form
   

lpd gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aceF yacH lpd ArcA CRP ArcA Fis TSS_254 TSS_254 TSS_253 TSS_253 TSS_252 TSS_252 TSS_251 TSS_251 TSS_250 TSS_250 TSS_249 TSS_249 TSS_248 TSS_248 lpdAp lpdAp TSS_247 TSS_247 TSS_246 TSS_246

Gene      
Name: lpd    Texpresso search in the literature
Synonym(s): ECK0115, EG10543, b0116, dhl, lpdA
Genome position(nucleotides): 127912 --> 129336 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.05
External database links:  
ASAP:
ABE-0000404
CGSC:
544
ECHOBASE:
EB0538
ECOLIHUB:
lpd
ECOO157CYC:
LPDA
MIM:
246900
NCBI-GENE:
944854
OU-MICROARRAY:
b0116
STRING:
511145.b0116
COLOMBOS: lpd


Product      
Name: lipoamide dehydrogenase
Synonym(s): Dhl, E3 subunit, Lpd, LpdA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 50.688
Isoelectric point: 6.071
Motif(s):
 
Type Positions Sequence
2 -> 474 STEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVINQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRIWDSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVTAVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKLIFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK
270 -> 273 AIGR
347 -> 455 IPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKLIFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLA
182 -> 186 GGGII
8 -> 328 QVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVINQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRIWDSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVTAVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.3 - pyruvate dehydrogenase
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.17 - formyl-THF biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005960 - glycine cleavage complex
GO:0045248 - cytosolic oxoglutarate dehydrogenase complex
GO:0045250 - cytosolic pyruvate dehydrogenase complex
GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0008270 - zinc ion binding
GO:0050660 - flavin adenine dinucleotide binding
GO:0004148 - dihydrolipoyl dehydrogenase activity
GO:0016668 - oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor
GO:0015036 - disulfide oxidoreductase activity
GO:0042802 - identical protein binding
biological_process GO:0006090 - pyruvate metabolic process
GO:0006096 - glycolytic process
GO:0006979 - response to oxidative stress
GO:0019464 - glycine decarboxylation via glycine cleavage system
GO:0045454 - cell redox homeostasis
GO:0006103 - 2-oxoglutarate metabolic process
External database links:  
DIP:
DIP-6854N
ECOCYC:
E3-MONOMER
ECOLIWIKI:
b0116
INTERPRO:
IPR004099
INTERPRO:
IPR006258
INTERPRO:
IPR012999
INTERPRO:
IPR001100
INTERPRO:
IPR016156
INTERPRO:
IPR036188
INTERPRO:
IPR023753
MODBASE:
P0A9P0
PDB:
4JDR
PFAM:
PF02852
PFAM:
PF07992
PRIDE:
P0A9P0
PRODB:
PRO_000023109
PROSITE:
PS00076
REFSEQ:
NP_414658
SMR:
P0A9P0
SWISSMODEL:
P0A9P0
UNIPROT:
P0A9P0


Operon      
Name: pdhR-aceEF-lpd         
Operon arrangement:
Transcription unit        Promoter
pdhR-aceEF-lpdA
pdhR-aceEF-lpdA
aceEF
aceEF
lpdA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Fur, FNR, Fis
Repressed by: CRP, FNR, Fur, Cra, ArcA, BtsR, PdhR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_246 127432 forward nd [RS-EPT-CBR] [1]
  promoter TSS_247 127436 forward nd [RS-EPT-CBR] [1]
  promoter TSS_248 127896 forward nd [RS-EPT-CBR] [1]
  promoter TSS_249 127898 forward nd [RS-EPT-CBR] [1]
  promoter TSS_250 127900 forward nd [RS-EPT-CBR] [1]
  promoter TSS_251 127907 forward nd [RS-EPT-CBR] [1]
  promoter TSS_252 127929 forward nd [RS-EPT-CBR] [1]
  promoter TSS_253 127953 forward nd [RS-EPT-CBR] [1]
  promoter TSS_254 130229 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB