RegulonDB RegulonDB 10.7: Gene Form
   

lpp gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pykF ldtE lpp TSS_1983 TSS_1983 TSS_1982 (cluster) TSS_1982 (cluster) TSS_1981 TSS_1981 TSS_1980 TSS_1980 TSS_1979 TSS_1979 lpp lpp lppp2 lppp2 TSS_1977 TSS_1977 TSS_1976 TSS_1976 TSS_1975 TSS_1975 TSS_1974 TSS_1974 TSS_1973 (cluster) TSS_1973 (cluster) TSS_1972 TSS_1972 TSS_1971 TSS_1971

Gene      
Name: lpp    Texpresso search in the literature
Synonym(s): ECK1673, EG10544, b1677, mlpA
Genome position(nucleotides): 1757421 --> 1757657 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.63
External database links:  
ASAP:
ABE-0005603
CGSC:
543
ECHOBASE:
EB0539
OU-MICROARRAY:
b1677
PORTECO:
lpp
REGULONDB:
b1677
STRING:
511145.b1677
M3D: lpp
COLOMBOS: lpp
PortEco: b1677


Product      
Name: murein lipoprotein
Synonym(s): Lpp, MlpA
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane,cell wall,extracellular space,periplasmic space
Molecular weight: 8.323
Isoelectric point: 9.853
Motif(s):
 
Type Positions Sequence
77 -> 77 R
43 -> 43 Q
26 -> 78 KIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK
70 -> 70 D
21 -> 78 CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  6 - cell structure --> 6.1 - membrane
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0019867 - outer membrane
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005576 - extracellular region
GO:0005618 - cell wall
GO:0031230 - intrinsic component of cell outer membrane
GO:0045203 - integral component of cell outer membrane
molecular_function GO:0005515 - protein binding
GO:0008289 - lipid binding
GO:0042802 - identical protein binding
GO:0042834 - peptidoglycan binding
biological_process GO:0043580 - periplasmic space organization
GO:0030258 - lipid modification
Reference(s): [1] Bosch V., et al., 1973
[2] Braun V., et al., 1972
[3] Braun V., et al., 1972
[4] Braun V., et al., 1973
[5] Braun V., et al., 1970
[6] Braun V., et al., 1970
[7] Hirashima A., et al., 1974
[8] Inouye M., et al., 1972
External database links:  
DIP:
DIP-35674N
ECOCYC:
EG10544-MONOMER
ECOLIWIKI:
b1677
INTERPRO:
IPR016367
INTERPRO:
IPR006817
MODBASE:
P69776
PANTHER:
PTHR38763
PDB:
2GUV
PDB:
2GUS
PDB:
1T8Z
PDB:
1MLP
PDB:
1KFN
PDB:
1KFM
PDB:
1JCD
PDB:
1JCC
PDB:
1EQ7
PFAM:
PF04728
PRIDE:
P69776
PRODB:
PRO_000023112
PROSITE:
PS51257
PROTEINMODELPORTAL:
P69776
REFSEQ:
NP_416192
SMR:
P69776
UNIPROT:
P69776


Operon      
Name: lpp         
Operon arrangement:
Transcription unit        Promoter
lpp
lpp
lpp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1971 1755742 forward nd [RS-EPT-CBR] [9]
  promoter TSS_1972 1755764 forward nd [RS-EPT-CBR] [9]
  promoter TSS_1973 (cluster) 1756032 forward For this promoter, there
Read more >
[RS-EPT-CBR] [9]
  promoter TSS_1974 1756122 forward nd [RS-EPT-CBR] [9]
  promoter TSS_1975 1756213 forward nd [RS-EPT-CBR] [9]
  promoter TSS_1976 1756218 forward nd [RS-EPT-CBR] [9]
  promoter TSS_1977 1756232 forward nd [RS-EPT-CBR] [9]
  promoter TSS_1979 1757387 forward nd [RS-EPT-CBR] [9]
  promoter TSS_1980 1757395 forward nd [RS-EPT-CBR] [9]
  promoter TSS_1981 1757425 forward nd [RS-EPT-CBR] [9]
  promoter TSS_1982 (cluster) 1757506 forward For this promoter, there
Read more >
[RS-EPT-CBR] [9]
  promoter TSS_1983 1757512 forward nd [RS-EPT-CBR] [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bosch V., Braun V., 1973, Distribution of murein-lipoprotein between the cytoplasmic and outer membrane of Escherichia coli., FEBS Lett 34(2):307-10

 [2] Braun V., Bosch V., 1972, Repetitive sequences in the murein-lipoprotein of the cell wall of Escherichia coli., Proc Natl Acad Sci U S A 69(4):970-4

 [3] Braun V., Bosch V., 1972, Sequence of the murein-lipoprotein and the attachment site of the lipid., Eur J Biochem 28(1):51-69

 [4] Braun V., Bosch V., 1973, In vivo biosynthesis of murein-lipoprotein of the outer membrane of E. coli., FEBS Lett 34(2):302-6

 [5] Braun V., Sieglin U., 1970, The covalent murein-lipoprotein structure of the Escherichia coli cell wall. The attachment site of the lipoprotein on the murein., Eur J Biochem 13(2):336-46

 [6] Braun V., Wolff H., 1970, The murein-lipoprotein linkage in the cell wall of Escherichia coli., Eur J Biochem 14(2):387-91

 [7] Hirashima A., Wang S., Inouye M., 1974, Cell-free synthesis of a specific lipoprotein of the Escherichia coli outer membrane directed by purified messenger RNA., Proc Natl Acad Sci U S A 71(10):4149-53

 [8] Inouye M., Shaw J., Shen C., 1972, The assembly of a structural lipoprotein in the envelope of Escherichia coli., J Biol Chem 247(24):8154-9

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB