RegulonDB RegulonDB 10.8: Gene Form
   

lrp gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ftsK trxB lrp LexA NsrR Lrp Lrp Lrp Lrp NarL FNR NarL ppGpp ppGpp anti-anti-terminator anti-terminator TSS_1079 TSS_1079 TSS_1078 TSS_1078 TSS_1077 TSS_1077 TSS_1076 TSS_1076 TSS_1075 TSS_1075 TSS_1074 TSS_1074 TSS_1073 TSS_1073 TSS_1072 TSS_1072 TSS_1071 TSS_1071 TSS_1070 TSS_1070 TSS_1069 TSS_1069 TSS_1068 TSS_1068 TSS_1067 TSS_1067 TSS_1066 TSS_1066 TSS_1065 TSS_1065 ftsKp3 ftsKp3 TSS_1064 TSS_1064 ftsKp1 ftsKp1 TSS_1063 (cluster) TSS_1063 (cluster) ftsKp2 ftsKp2 TSS_1062 TSS_1062 TSS_1061 TSS_1061 TSS_1060 TSS_1060 lrpp lrpp trxBp trxBp

Gene      
Name: lrp    Texpresso search in the literature
Synonym(s): ECK0880, EG10547, alsB, b0889, ihb, livR, lrs, lss, lstR, mbf, oppI, rblA
Genome position(nucleotides): 932595 --> 933089 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.88
External database links:  
ASAP:
ABE-0003023
CGSC:
549
ECHOBASE:
EB0542
OU-MICROARRAY:
b0889
PortEco:
lrp
STRING:
511145.b0889
COLOMBOS: lrp


Product      
Name: DNA-binding transcriptional dual regulator Lrp
Synonym(s): AlsB, Ihb, LivR, Lrp, Lrs, Lss, LstR, Mbf, OppI, RblA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: AsnC
Cellular location: cytosol
Molecular weight: 18.887
Isoelectric point: 9.092
Motif(s):
 
Type Positions Sequence
78 -> 152 VEITLNRGAPDVFEQFNTAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEE
114 -> 114 D
12 -> 73 LDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLNPHYLDAS
2 -> 164 VDSKKRPGKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNTAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR
31 -> 50 NVELSKRVGLSPTPCLERVR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.18 - isoleucine/valine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.19 - leucine
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  2 - information transfer --> 2.3 - protein related --> 2.3.7 - nucleoproteins, basic proteins
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
GO:0042802 - identical protein binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0006524 - alanine catabolic process
GO:0043200 - response to amino acid
GO:0043201 - response to leucine
Note(s): Note(s): ...[more].
Reference(s): [1] Cui Y., et al., 1995
[2] Ernsting BR., et al., 1992
[3] Haney SA., et al., 1992
[4] Willins DA., et al., 1991
External database links:  
DIP:
DIP-35825N
ECOCYC:
PD00353
ECOLIWIKI:
b0889
INTERPRO:
IPR019887
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR019888
INTERPRO:
IPR019885
INTERPRO:
IPR011991
INTERPRO:
IPR011008
INTERPRO:
IPR000485
PDB:
2GQQ
PDB:
2L4A
PFAM:
PF01037
PRIDE:
P0ACJ0
PRINTS:
PR00033
PRODB:
PRO_000023126
PROSITE:
PS50956
PROSITE:
PS00519
REFSEQ:
NP_415409
SMART:
SM00344
SMR:
P0ACJ0
UNIPROT:
P0ACJ0


Operon      
Name: lrp         
Operon arrangement:
Transcription unit        Promoter
lrp


Transcriptional Regulation      
Display Regulation             
Activated by: GadE
Repressed by: NsrR, H-NS, Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1060 932431 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1061 932507 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1062 932525 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1063 (cluster) 933135 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1064 933181 forward nd [RS-EPT-CBR] [5]
  promoter ftsKp3 933218 forward We assigned a putative transcription
Read more >
[AIPP] [6]
  promoter TSS_1065 933716 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1066 934543 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1067 934547 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1068 934549 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1069 935748 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1070 936467 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1071 936562 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1072 936567 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1073 936589 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1074 936705 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1075 936711 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1076 936713 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1077 936735 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1078 936737 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1079 936755 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [AIPP] Automated inference of promoter position



Reference(s)    

 [1] Cui Y., Wang Q., Stormo GD., Calvo JM., 1995, A consensus sequence for binding of Lrp to DNA., J Bacteriol 177(17):4872-80

 [2] Ernsting BR., Atkinson MR., Ninfa AJ., Matthews RG., 1992, Characterization of the regulon controlled by the leucine-responsive regulatory protein in Escherichia coli., J Bacteriol 174(4):1109-18

 [3] Haney SA., Platko JV., Oxender DL., Calvo JM., 1992, Lrp, a leucine-responsive protein, regulates branched-chain amino acid transport genes in Escherichia coli., J Bacteriol 174(1):108-15

 [4] Willins DA., Ryan CW., Platko JV., Calvo JM., 1991, Characterization of Lrp, and Escherichia coli regulatory protein that mediates a global response to leucine., J Biol Chem 266(17):10768-74

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Lewis LK., Jenkins ME., Mount DW., 1992, Isolation of DNA damage-inducible promoters in Escherichia coli: regulation of polB (dinA), dinG, and dinH by LexA repressor., J Bacteriol 174(10):3377-85


RegulonDB