RegulonDB RegulonDB 10.9: Gene Form
   

lysA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lysA galR lysR ygeA TSS_3140 TSS_3140 lysAp lysAp lysRp lysRp TSS_3139 TSS_3139

Gene      
Name: lysA    Texpresso search in the literature
Synonym(s): ECK2836, EG10549, b2838
Genome position(nucleotides): 2977637 <-- 2978899 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.05
External database links:  
ASAP:
ABE-0009309
CGSC:
540
ECHOBASE:
EB0544
ECOLIHUB:
lysA
OU-MICROARRAY:
b2838
STRING:
511145.b2838
COLOMBOS: lysA


Product      
Name: diaminopimelate decarboxylase
Synonym(s): LysA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 46.177
Isoelectric point: 5.97
Motif(s):
 
Type Positions Sequence
268 -> 271 EPGR
32 -> 376 DAQIIRRQIAALKQFDVVRFAQKACSNIHILRLMREQGVKVDSVSLGEIERALAAGYNPQTHPDDIVFTADVIDQATLERVSELQIPVNAGSVDMLDQLGQVSPGHRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQRHHLQLVGIHMHIGSGVDYAHLEQVCGAMVRQVIEFGQDLQAISAGGGLSVPYQQGEEAVDTEHYYGLWNAAREQIARHLGHPVKLEIEPGRFLVAQSGVLITQVRSVKQMGSRHFVLVDAGFNDLMRPAMYGSYHHISALAADGRSLEHAPTVETVVAGPLCESGDVFTQQEGGNVETRALPEVKAGDYLVLHDTG
33 -> 275 AQIIRRQIAALKQFDVVRFAQKACSNIHILRLMREQGVKVDSVSLGEIERALAAGYNPQTHPDDIVFTADVIDQATLERVSELQIPVNAGSVDMLDQLGQVSPGHRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQRHHLQLVGIHMHIGSGVDYAHLEQVCGAMVRQVIEFGQDLQAISAGGGLSVPYQQGEEAVDTEHYYGLWNAAREQIARHLGHPVKLEIEPGRFLVA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.7 - lysine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0008836 - diaminopimelate decarboxylase activity
GO:0016831 - carboxy-lyase activity
GO:0030170 - pyridoxal phosphate binding
GO:0042803 - protein homodimerization activity
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0009085 - lysine biosynthetic process
GO:0009089 - lysine biosynthetic process via diaminopimelate
External database links:  
DIP:
DIP-10132N
ECOCYC:
DIAMINOPIMDECARB-MONOMER
ECOLIWIKI:
b2838
INTERPRO:
IPR022653
INTERPRO:
IPR029066
INTERPRO:
IPR022644
INTERPRO:
IPR022657
INTERPRO:
IPR000183
INTERPRO:
IPR002986
INTERPRO:
IPR009006
INTERPRO:
IPR022643
MODBASE:
P00861
PDB:
1KO0
PDB:
1KNW
PFAM:
PF02784
PFAM:
PF00278
PRIDE:
P00861
PRINTS:
PR01179
PRINTS:
PR01181
PRODB:
PRO_000023137
PROSITE:
PS00878
PROSITE:
PS00879
REFSEQ:
NP_417315
SMR:
P00861
UNIPROT:
P00861


Operon      
Name: lysA         
Operon arrangement:
Transcription unit        Promoter
lysA


Transcriptional Regulation      
Display Regulation             
Activated by: ArgP, LysR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3139 2977006 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3140 2978995 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB