RegulonDB RegulonDB 10.8: Gene Form
   

lysR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

araE lysA lysR ygeA anti-anti-terminator anti-terminator terminator ygeAp5 ygeAp5 TSS_3140 TSS_3140 lysAp lysAp lysRp lysRp

Gene      
Name: lysR    Texpresso search in the literature
Synonym(s): ECK2837, EG10551, b2839
Genome position(nucleotides): 2979021 --> 2979956 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.42
External database links:  
ASAP:
ABE-0009313
CGSC:
18187
ECHOBASE:
EB0546
OU-MICROARRAY:
b2839
PortEco:
lysR
STRING:
511145.b2839
COLOMBOS: lysR


Shine dalgarno      
Sequence: ccggattgcgAGAGAGcgctaATG


Product      
Name: DNA-binding transcriptional dual regulator LysR
Synonym(s): LysR, positive regulator for lys
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 34.365
Isoelectric point: 7.424
Motif(s):
 
Type Positions Sequence
21 -> 40 LTEAAHLLHTSQPTVSRELA
6 -> 64 LRHIEIFHAVMTAGSLTEAAHLLHTSQPTVSRELARFEKVIGLKLFERVRGRLHPTVQG
92 -> 293 RQGELSIACLPVFSQSFLPQLLQPFLARYPDVSLNIVPQESPLLEEWLSAQRHDLGLTETLHTPAGTERTELLSLDEVCVLPPGHPLAVKKVLTPDDFQGENYISLSRTDSYRQLLDQLFTEHQVKRRMIVETHSAASVCAMVRAGVGISVVNPLTALDYAASGLVVRRFSIAVPFTVSLIRPLHRPSSALVQAFSGHLQAG
1 -> 61 MAAVNLRHIEIFHAVMTAGSLTEAAHLLHTSQPTVSRELARFEKVIGLKLFERVRGRLHPT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.7 - lysine
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0009089 - lysine biosynthetic process via diaminopimelate
GO:0010628 - positive regulation of gene expression
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Stragier P., et al., 1983
External database links:  
DIP:
DIP-10135N
ECOCYC:
PD00360
ECOLIWIKI:
b2839
INTERPRO:
IPR005119
INTERPRO:
IPR037414
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR000847
MINT:
MINT-1320169
MODBASE:
P03030
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
P03030
PRINTS:
PR00039
PRODB:
PRO_000023140
PROSITE:
PS50931
REFSEQ:
NP_417316
SMR:
P03030
UNIPROT:
P03030


Operon      
Name: lysR         
Operon arrangement:
Transcription unit        Promoter
lysR


Transcriptional Regulation      
Display Regulation             
Repressed by: LysR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3140 2978995 forward nd [RS-EPT-CBR] [2]
  promoter ygeAp5 2980803 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Stragier P., Patte JC., 1983, Regulation of diaminopimelate decarboxylase synthesis in Escherichia coli. III. Nucleotide sequence and regulation of the lysR gene., J Mol Biol 168(2):333-50

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB