RegulonDB RegulonDB 10.6.3: Gene Form
   

malF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

malF malE malG Fis TSS_4874 TSS_4874 TSS_4873 TSS_4873 TSS_4872 TSS_4872

Gene      
Name: malF    Texpresso search in the literature
Synonym(s): ECK4025, EG10555, b4033
Genome position(nucleotides): 4243531 <-- 4245075 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.27
External database links:  
ASAP:
ABE-0013195
CGSC:
531
ECHOBASE:
EB0550
ECOCYC:
EG10555
ECOLIHUB:
malF
OU-MICROARRAY:
b4033
REGULONDB:
b4033
STRING:
511145.b4033
M3D: malF
COLOMBOS: malF
PortEco: b4033


Product      
Name: maltose ABC transporter membrane subunit MalF
Synonym(s): MalF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 57.013
Isoelectric point: 8.595
Motif(s):
 
Type Positions Sequence
19 -> 35 VLGLLGLLVGYLVVLMY
298 -> 501 VGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGAL
372 -> 372 L
403 -> 403 S
41 -> 57 LFAITTLILSSAGLYIF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
GO:1990060 - maltose transport complex
molecular_function GO:0005515 - protein binding
GO:0015423 - maltose-transporting ATPase activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0008643 - carbohydrate transport
GO:0015768 - maltose transport
GO:0042956 - maltodextrin transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Boyd D., et al., 1987
[2] Ehrle R., et al., 1996
[3] Ehrmann M., et al., 1991
[4] Ehrmann M., et al., 1990
[5] Froshauer S., et al., 1988
[6] McGovern K., et al., 1991
[7] Steinke A., et al., 2001
External database links:  
DIP:
DIP-10142N
ECOCYC:
MALF-MONOMER
ECOLIWIKI:
b4033
INTERPRO:
IPR029345
INTERPRO:
IPR030156
INTERPRO:
IPR035277
INTERPRO:
IPR035906
INTERPRO:
IPR000515
PANTHER:
PTHR30193:SF22
PDB:
4KHZ
PDB:
4KI0
PDB:
4JBW
PDB:
3RLF
PDB:
3PV0
PDB:
3PUZ
PDB:
3PUY
PDB:
3PUX
PDB:
3PUW
PDB:
3PUV
PDB:
3FH6
PDB:
2r6g
PFAM:
PF14785
PFAM:
PF00528
PRIDE:
P02916
PRODB:
PRO_000023148
PROSITE:
PS50928
PROTEINMODELPORTAL:
P02916
REFSEQ:
NP_418457
SMR:
P02916
UNIPROT:
P02916


Operon      
Name: malEFG         
Operon arrangement:
Transcription unit        Promoter
malEFG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, MalT, Fis
Repressed by: CreB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4872 4242704 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_4873 4242731 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_4874 4242830 reverse nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Boyd D., Manoil C., Beckwith J., 1987, Determinants of membrane protein topology., Proc Natl Acad Sci U S A 84(23):8525-9

 [2] Ehrle R., Pick C., Ulrich R., Hofmann E., Ehrmann M., 1996, Characterization of transmembrane domains 6, 7, and 8 of MalF by mutational analysis., J Bacteriol 178(8):2255-62

 [3] Ehrmann M., Beckwith J., 1991, Proper insertion of a complex membrane protein in the absence of its amino-terminal export signal., J Biol Chem 266(25):16530-3

 [4] Ehrmann M., Boyd D., Beckwith J., 1990, Genetic analysis of membrane protein topology by a sandwich gene fusion approach., Proc Natl Acad Sci U S A 87(19):7574-8

 [5] Froshauer S., Green GN., Boyd D., McGovern K., Beckwith J., 1988, Genetic analysis of the membrane insertion and topology of MalF, a cytoplasmic membrane protein of Escherichia coli., J Mol Biol 200(3):501-11

 [6] McGovern K., Ehrmann M., Beckwith J., 1991, Decoding signals for membrane protein assembly using alkaline phosphatase fusions., EMBO J 10(10):2773-82

 [7] Steinke A., Grau S., Davidson A., Hofmann E., Ehrmann M., 2001, Characterization of transmembrane segments 3, 4, and 5 of MalF by mutational analysis., J Bacteriol 183(1):375-81

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB