RegulonDB RegulonDB 10.7: Gene Form
   

malT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

malT malP rtcA Mlc CRP FNR MalT MalT MalT MalT TSS_4026 TSS_4026 TSS_4025 TSS_4025 TSS_4024 TSS_4024 TSS_4023 TSS_4023 TSS_4022 TSS_4022 TSS_4021 TSS_4021 TSS_4020 TSS_4020 TSS_4019 TSS_4019 TSS_4018 (cluster) TSS_4018 (cluster) TSS_4017 TSS_4017 malTp malTp malPp malPp TSS_4014 TSS_4014 malQp malQp

Gene      
Name: malT    Texpresso search in the literature
Synonym(s): ECK3405, EG10562, b3418, malA
Genome position(nucleotides): 3553085 --> 3555790 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.1
External database links:  
ASAP:
ABE-0011162
CGSC:
526
ECHOBASE:
EB0557
OU-MICROARRAY:
b3418
PORTECO:
malT
REGULONDB:
b3418
STRING:
511145.b3418
M3D: malT
COLOMBOS: malT
PortEco: b3418


Product      
Name: DNA-binding transcriptional activator MalT
Synonym(s): MalA, MalT
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LuxR/UhpA
Cellular location: cytosol
Molecular weight: 103.118
Isoelectric point: 6.465
Motif(s):
 
Type Positions Sequence
1 -> 241 MLIPSKLSRPVRLDHTVVRERLLAKLSGANNFRLALITSPAGYGKTTLISQWAAGKNDIGWYSLDEGDNQQERFASYLIAAVQQATNGHCAICETMAQKRQYASLTSLFAQLFIELAEWHSPLYLVIDDYHLITNPVIHESMRFFIRHQPENLTLVVLSRNLPQLGIANLRVRDQLLEIGSQQLAFTHQEAKQFFDCRLSSPIEAAESSRICDDVSGWATALQLIALSARQNTHSAHKSAR
437 -> 806 HEIKDIREDTMHAEFNALRAQVAINDGNPDEAERLAKLALEELPPGWFYSRIVATSVLGEVLHCKGELTRSLALMQQTEQMARQHDVWHYALWSLIQQSEILFAQGFLQTAWETQEKAFQLINEQHLEQLPMHEFLVRIRAQLLWAWARLDEAEASARSGIEVLSSYQPQQQLQCLAMLIQCSLARGDLDNARSQLNRLENLLGNGKYHSDWISNANKVRVIYWQMTGDKAAAANWLRHTAKPEFANNHFLQGQWRNIARAQILLGEFEPAEIVLEELNENARSLRLMSDLNRNLLLLNQLYWQAGRKSDAQRVLLDALKLANRTGFISHFVIEGEAMAQQLRQLIQLNTLPELEQHRAQRILREINQHH
39 -> 46 SPAGYGKT
853 -> 872 NEQIAGELEVAATTIKTHIR
449 -> 781 AEFNALRAQVAINDGNPDEAERLAKLALEELPPGWFYSRIVATSVLGEVLHCKGELTRSLALMQQTEQMARQHDVWHYALWSLIQQSEILFAQGFLQTAWETQEKAFQLINEQHLEQLPMHEFLVRIRAQLLWAWARLDEAEASARSGIEVLSSYQPQQQLQCLAMLIQCSLARGDLDNARSQLNRLENLLGNGKYHSDWISNANKVRVIYWQMTGDKAAAANWLRHTAKPEFANNHFLQGQWRNIARAQILLGEFEPAEIVLEELNENARSLRLMSDLNRNLLLLNQLYWQAGRKSDAQRVLLDALKLANRTGFISHFVIEGEAMAQQLRQL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
GO:0048031 - trisaccharide binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006355 - regulation of transcription, DNA-templated
GO:0045913 - positive regulation of carbohydrate metabolic process
GO:0045893 - positive regulation of transcription, DNA-templated
Reference(s): [1] Cole ST., et al., 1986
[2] Richet E., et al., 1989
External database links:  
DIP:
DIP-10149N
ECOCYC:
PD00237
ECOLIWIKI:
b3418
INTERPRO:
IPR000792
INTERPRO:
IPR011990
INTERPRO:
IPR016032
INTERPRO:
IPR036388
INTERPRO:
IPR023768
INTERPRO:
IPR027417
INTERPRO:
IPR041617
MINT:
MINT-1233939
MODBASE:
P06993
PDB:
1HZ4
PFAM:
PF17874
PFAM:
PF00196
PRIDE:
P06993
PRINTS:
PR00038
PRODB:
PRO_000023155
PROSITE:
PS00622
PROSITE:
PS50043
PROTEINMODELPORTAL:
P06993
REFSEQ:
NP_417877
SMART:
SM00421
SMR:
P06993
UNIPROT:
P06993


Operon      
Name: malT         
Operon arrangement:
Transcription unit        Promoter
malT


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Lrp
Repressed by: Mlc


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4014 3552499 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4017 3553091 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4018 (cluster) 3553664 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4019 3553757 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4020 3553836 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4021 3553843 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4022 3554481 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4023 3554746 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4024 3555139 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4025 3555545 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4026 3555555 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Cole ST., Raibaud O., 1986, The nucleotide sequence of the malT gene encoding the positive regulator of the Escherichia coli maltose regulon., Gene 42(2):201-8

 [2] Richet E., Raibaud O., 1989, MalT, the regulatory protein of the Escherichia coli maltose system, is an ATP-dependent transcriptional activator., EMBO J 8(3):981-7

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB