RegulonDB RegulonDB 10.6.3: Gene Form
   

malY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

malX malY add RbsR terminator anti-terminator anti-anti-terminator TSS_1901 TSS_1901 addp6 addp6 TSS_1900 TSS_1900

Gene      
Name: malY    Texpresso search in the literature
Synonym(s): ECK1617, EG10564, b1622
Genome position(nucleotides): 1700957 --> 1702129 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.98
External database links:  
ASAP:
ABE-0005432
CGSC:
32257
ECHOBASE:
EB0559
ECOCYC:
EG10564
ECOLIHUB:
malY
OU-MICROARRAY:
b1622
REGULONDB:
b1622
STRING:
511145.b1622
M3D: malY
COLOMBOS: malY
PortEco: b1622


Shine dalgarno      
Sequence: gtccaggcatAAGGATaagatATG


Product      
Name: negative regulator of MalT activity/cystathionine β-lyase
Synonym(s): MalY, bifunctional beta;-cystathionase, PLP-dependent and regulator of maltose regulon
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 43.642
Isoelectric point: 5.105
Motif(s):
 
Type Positions Sequence
233 -> 233 K
30 -> 379 LLPFTISDMDFATAPCIIEALNQRLMHGVFGYSRWKNDEFLAAIAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGEGVVIHTPAYDAFYKAIEGNQRTVMPVALEKQADGWFCDMGKLEAVLAKPECKIMLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVWGEQPHIPWSNVARGDWALLTSGSKSFNIPALTGAYGIIENSSSRDAYLSALKGRDGLSSPSVLALTAHIAAYQQGAPWLDALRIYLKDNLTYIADKMNAAFPELNWQIPQSTYLAWLDLRPLNIDDNALQKALIEQEKVAIMPGYTYGEEGRGFVRLNAGCPRSKLEKGV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0047804 - cysteine-S-conjugate beta-lyase activity
GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0030170 - pyridoxal phosphate binding
GO:0004121 - cystathionine beta-lyase activity
GO:0042803 - protein homodimerization activity
GO:0080146 - L-cysteine desulfhydrase activity
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0009058 - biosynthetic process
GO:0009086 - methionine biosynthetic process
GO:0043433 - negative regulation of DNA-binding transcription factor activity
External database links:  
DIP:
DIP-10151N
ECOCYC:
EG10564-MONOMER
ECOLIWIKI:
b1622
INTERPRO:
IPR015422
INTERPRO:
IPR027619
INTERPRO:
IPR015424
INTERPRO:
IPR015421
INTERPRO:
IPR004839
MODBASE:
P23256
PDB:
1D2F
PFAM:
PF00155
PRIDE:
P23256
PRODB:
PRO_000023157
PROSITE:
PS00599
PROTEINMODELPORTAL:
P23256
REFSEQ:
NP_416139
SMR:
P23256
UNIPROT:
P23256


Operon      
Name: malXY         
Operon arrangement:
Transcription unit        Promoter
malXY


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: MalI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1900 1700840 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1901 1702204 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB