RegulonDB RegulonDB 10.8: Gene Form
   

manA gene in Escherichia coli K-12 genome

Gene      
Name: manA    Texpresso search in the literature
Synonym(s): ECK1608, EG10566, b1613, pmi
Genome position(nucleotides): 1688576 --> 1689751 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.77
External database links:  
ASAP:
ABE-0005398
CGSC:
525
ECHOBASE:
EB0561
MIM:
602579
OU-MICROARRAY:
b1613
PortEco:
manA
STRING:
511145.b1613
COLOMBOS: manA


Product      
Name: mannose-6-phosphate isomerase
Synonym(s): ManA, Pmi
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.85
Isoelectric point: 5.13
Motif(s):
 
Type Positions Sequence
1 -> 357 MQKLINSVQNYAWGSKTALTELYGMENPSSQPMAELWMGAHPKSSSRVQNAAGDIVSLRDVIESDKSTLLGEAVAKRFGELPFLFKVLCAAQPLSIQVHPNKHNSEIGFAKENAAGIPMDAAERNYKDPNHKPELVFALTPFLAMNAFREFSEIVSLLQPVAGAHPAIAHFLQQPDAERLSELFASLLNMQGEEKSRALAILKSALDSQQGEPWQTIRLISEFYPEDSGLFSPLLLNVVKLNPGEAMFLFAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELVANVKFEAKPANQLLTQPVKQGAELDFPIPVDDFAFSLHDLSDKETTISQQSAAILFCVEGDATLWKGSQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.10 - sugar nucleotide biosynthesis, conversions
  5 - cell processes --> 5.5 - adaptations --> 5.5.5 - dessication
  6 - cell structure --> 6.7 - capsule (M and K antigens)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0004476 - mannose-6-phosphate isomerase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0009242 - colanic acid biosynthetic process
GO:0006486 - protein glycosylation
GO:0009298 - GDP-mannose biosynthetic process
GO:0019309 - mannose catabolic process
GO:0000032 - cell wall mannoprotein biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10153N
ECOCYC:
MANNPISOM-MONOMER
ECOLIWIKI:
b1613
INTERPRO:
IPR014710
INTERPRO:
IPR018050
INTERPRO:
IPR016305
INTERPRO:
IPR011051
INTERPRO:
IPR001250
MINT:
MINT-1241491
MODBASE:
P00946
PANTHER:
PTHR10309
PFAM:
PF01238
PRIDE:
P00946
PRINTS:
PR00714
PROSITE:
PS00966
PROSITE:
PS00965
REFSEQ:
NP_416130
SMR:
P00946
UNIPROT:
P00946


Operon      
Name: manA         
Operon arrangement:
Transcription unit        Promoter
manA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1895 1688441 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1897 1689797 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB