RegulonDB RegulonDB 10.8: Gene Form
   

manY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

manX manZ manY anti-terminator anti-anti-terminator TSS_2171 TSS_2171 TSS_2170 TSS_2170 TSS_2169 TSS_2169 TSS_2168 TSS_2168 TSS_2167 TSS_2167 TSS_2166 TSS_2166 TSS_2165 (cluster) TSS_2165 (cluster) TSS_2164 TSS_2164 TSS_2163 TSS_2163 TSS_2162 TSS_2162 TSS_2161 TSS_2161 TSS_2160 (cluster) TSS_2160 (cluster) TSS_2159 TSS_2159 TSS_2158 TSS_2158 TSS_2157 TSS_2157 TSS_2156 (cluster) TSS_2156 (cluster) TSS_2155 TSS_2155 TSS_2154 TSS_2154 TSS_2153 TSS_2153 TSS_2152 TSS_2152 TSS_2151 TSS_2151 TSS_2150 TSS_2150 TSS_2149 TSS_2149 TSS_2148 TSS_2148 TSS_2147 (cluster) TSS_2147 (cluster) TSS_2146 TSS_2146 TSS_2145 TSS_2145

Gene      
Name: manY    Texpresso search in the literature
Synonym(s): ECK1816, EG10568, b1818, pel, ptsM, ptsP, ptsX
Genome position(nucleotides): 1903082 --> 1903882 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.56
External database links:  
ASAP:
ABE-0006056
CGSC:
18175
ECHOBASE:
EB0563
OU-MICROARRAY:
b1818
PortEco:
manY
STRING:
511145.b1818
COLOMBOS: manY


Product      
Name: mannose-specific PTS enzyme IIC component
Synonym(s): Enzyme IICman, II-Man, II-Pman, IICMan, ManY, Pel, PtsM, PtsP, PtsX
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 27.636
Isoelectric point: 4.774
Motif(s):
 
Type Positions Sequence
5 -> 24 TLQIVLVFIVACIAGMGSIL
3 -> 237 ITTLQIVLVFIVACIAGMGSILDEFQFHRPLIACTLVGIVLGDMKTGIIIGGTLEMIALGWMNIGAAVAPDAALASIISTILVIAGHQSIGAGIALAIPLAAAGQVLTIIVRTITVAFQHAADKAADNGNLTAISWIHVSSLFLQAMRVAIPAVIVALSVGTSEVQNMLNAIPEVVTNGLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNFNLVALGVIGTVMAVL
106 -> 124 GQVLTIIVRTITVAFQHAA
151 -> 170 VAIPAVIVALSVGTSEVQNM
182 -> 201 LNIAGGMIVVVGYAMVINMM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022870 - protein-N(PI)-phosphohistidine-mannose phosphotransferase system transporter activity
biological_process GO:0098708 - glucose import across plasma membrane
GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0015764 - N-acetylglucosamine transport
GO:0015761 - mannose transmembrane transport
GO:0032445 - fructose import
Note(s): Note(s): ...[more].
Reference(s): [1] Mao Q., et al., 1995
External database links:  
ECOCYC:
MANY-MONOMER
ECOLIWIKI:
b1818
INTERPRO:
IPR004700
PANTHER:
PTHR32502:SF4
PFAM:
PF03609
PRIDE:
P69801
PRODB:
PRO_000023162
PROSITE:
PS51106
REFSEQ:
NP_416332
UNIPROT:
P69801


Operon      
Name: manXYZ         
Operon arrangement:
Transcription unit        Promoter
manXYZ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: NagC, Mlc, Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2145 1902072 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2146 1902618 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2147 (cluster) 1903044 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2148 1903052 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2149 1903059 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2150 1903166 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2151 1903202 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2152 1903244 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2153 1903321 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2154 1903409 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2155 1903587 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2156 (cluster) 1903744 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2157 1903789 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2158 1903802 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2159 1903806 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2160 (cluster) 1903812 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2161 1903815 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2162 1903818 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2163 1903821 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2164 1903823 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2165 (cluster) 1903860 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2166 1903863 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2167 1903867 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2168 1903873 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2169 1903946 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2170 1903975 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2171 1904505 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Mao Q., Schunk T., Flukiger K., Erni B., 1995, Functional reconstitution of the purified mannose phosphotransferase system of Escherichia coli into phospholipid vesicles., J Biol Chem 270(10):5258-65

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB