RegulonDB RegulonDB 10.8: Gene Form
   

mepA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aroC mepA yfcA epmC TSS_2645 TSS_2645 TSS_2644 (cluster) TSS_2644 (cluster) TSS_2643 TSS_2643 TSS_2642 TSS_2642 TSS_2641 (cluster) TSS_2641 (cluster) TSS_2640 (cluster) TSS_2640 (cluster) TSS_2639 (cluster) TSS_2639 (cluster) TSS_2638 TSS_2638 TSS_2637 TSS_2637 yfcLp5 yfcLp5

Gene      
Name: mepA    Texpresso search in the literature
Synonym(s): ECK2322, EG10580, b2328
Genome position(nucleotides): 2445560 <-- 2446384 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.39
External database links:  
ASAP:
ABE-0007691
CGSC:
17650
ECHOBASE:
EB0575
OU-MICROARRAY:
b2328
PortEco:
mepA
STRING:
511145.b2328
COLOMBOS: mepA


Product      
Name: peptidoglycan DD-endopeptidase/peptidoglycan LD-endopeptidase
Synonym(s): MepA
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 30.137
Isoelectric point: 8.39
Motif(s):
 
Type Positions Sequence
36 -> 270 SIGSFSNGCIVGADTLPIQSEHYQVMRTDQRRYFGHPDLVMFIQRLSSQVSNLGMGTVLIGDMGMPAGGRFNGGHASHQTGLDVDIFLQLPKTRWTSAQLLRPQALDLVSRDGKHVVSTLWKPEIFSLIKLAAQDKDVTRIFVNPAIKQQLCLDAGTDRDWLRKVRPWFQHRAHMHVRLRCPADSLECEDQPLPPSGDGCGAELQSWFEPPKPGTTKPEKKTPPPLPPSCQALLD
20 -> 274 ATPWQKITQPVPGSAQSIGSFSNGCIVGADTLPIQSEHYQVMRTDQRRYFGHPDLVMFIQRLSSQVSNLGMGTVLIGDMGMPAGGRFNGGHASHQTGLDVDIFLQLPKTRWTSAQLLRPQALDLVSRDGKHVVSTLWKPEIFSLIKLAAQDKDVTRIFVNPAIKQQLCLDAGTDRDWLRKVRPWFQHRAHMHVRLRCPADSLECEDQPLPPSGDGCGAELQSWFEPPKPGTTKPEKKTPPPLPPSCQALLDEHVI
1 -> 19 MNKTAIALLALLASSASLA
113 -> 113 H
209 -> 209 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004175 - endopeptidase activity
GO:0004222 - metalloendopeptidase activity
GO:0004252 - serine-type endopeptidase activity
GO:0008237 - metallopeptidase activity
biological_process GO:0000270 - peptidoglycan metabolic process
GO:0006508 - proteolysis
GO:0009252 - peptidoglycan biosynthetic process
GO:0042493 - response to drug
External database links:  
ECOCYC:
EG10580-MONOMER
ECOLIWIKI:
b2328
INTERPRO:
IPR005073
INTERPRO:
IPR009045
PDB:
1TZP
PDB:
1U10
PFAM:
PF03411
PRIDE:
P0C0T5
PRODB:
PRO_000023207
REFSEQ:
NP_416831
SMR:
P0C0T5
UNIPROT:
P0C0T5


Operon      
Name: prmB-aroC-mepA-yfcA-epmC-yfcL         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfcLp5 2444251 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2637 2444742 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2638 2444784 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2639 (cluster) 2444800 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2640 (cluster) 2444805 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2641 (cluster) 2444859 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2642 2444872 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2643 2444876 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2644 (cluster) 2444884 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2645 2445745 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB