RegulonDB RegulonDB 10.6.3: Gene Form
   

metH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

metH yjbB iclR MetR FadR IclR Fur terminator TSS_4843 TSS_4843 TSS_4842 TSS_4842 TSS_4841 TSS_4841 yjbBp yjbBp TSS_4839 TSS_4839 metHp metHp iclRp iclRp metHp2 metHp2

Gene      
Name: metH    Texpresso search in the literature
Synonym(s): ECK4011, EG10587, b4019
Genome position(nucleotides): 4223828 --> 4227511 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.84
External database links:  
ASAP:
ABE-0013140
CGSC:
509
ECHOBASE:
EB0582
ECOCYC:
EG10587
ECOLIHUB:
metH
MIM:
603174
MIM:
250940
MIM:
601634
NCBI-GENE:
948522
OU-MICROARRAY:
b4019
REGULONDB:
b4019
STRING:
511145.b4019
M3D: metH
COLOMBOS: metH
PortEco: b4019


Product      
Name: cobalamin-dependent methionine synthase
Synonym(s): MetH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 135.996
Isoelectric point: 4.711
Motif(s):
 
Type Positions Sequence
310 -> 310 C
757 -> 757 D
2 -> 1227 SSKVEQLRAQLNERILVLDGGMGTMIQSYRLNEADFRGERFADWPCDLKGNNDLLVLSKPEVIAAIHNAYFEAGADIIETNTFNSTTIAMADYQMESLSAEINFAAAKLARACADEWTARTPEKPRYVAGVLGPTNRTASISPDVNDPAFRNITFDGLVAAYRESTKALVEGGADLILIETVFDTLNAKAAVFAVKTEFEALGVELPIMISGTITDASGRTLSGQTTEAFYNSLRHAEALTFGLNCALGPDELRQYVQELSRIAECYVTAHPNAGLPNAFGEYDLDADTMAKQIREWAQAGFLNIVGGCCGTTPQHIAAMSRAVEGLAPRKLPEIPVACRLSGLEPLNIGEDSLFVNVGERTNVTGSAKFKRLIKEEKYSEALDVARQQVENGAQIIDINMDEGMLDAEAAMVRFLNLIAGEPDIARVPIMIDSSKWDVIEKGLKCIQGKGIVNSISMKEGVDAFIHHAKLLRRYGAAVVVMAFDEQGQADTRARKIEICRRAYKILTEEVGFPPEDIIFDPNIFAVATGIEEHNNYAQDFIGACEDIKRELPHALISGGVSNVSFSFRGNDPVREAIHAVFLYYAIRNGMDMGIVNAGQLAIYDDLPAELRDAVEDVILNRRDDGTERLLELAEKYRGSKTDDTANAQQAEWRSWEVNKRLEYSLVKGITEFIEQDTEEARQQATRPIEVIEGPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAYLEPFIEASKEQGKTNGKMVIATVKGDVHDIGKNIVGVVLQCNNYEIVDLGVMVPAEKILRTAKEVNADLIGLSGLITPSLDEMVNVAKEMERQGFTIPLLIGGATTSKAHTAVKIEQNYSGPTVYVQNASRTVGVVAALLSDTQRDDFVARTRKEYETVRIQHGRKKPRTPPVTLEAARDNDFAFDWQAYTPPVAHRLGVQEVEASIETLRNYIDWTPFFMTWSLAGKYPRILEDEVVGVEAQRLFKDANDMLDKLSAEKTLNPRGVVGLFPANRVGDDIEIYRDETRTHVINVSHHLRQQTEKTGFANYCLADFVAPKLSGKADYIGAFAVTGGLEEDALADAFEAQHDDYNKIMVKALADRLAEAFAEYLHERVRKVYWGYAPNENLSNEELIRENYQGIRPAPGYPACPEHTEKATIWELLEVEKHTGMKLTESFAMWPGASVSGWYFSHPDSKYYAVAQIQRDQVEDYARRKGMSVTEVERWLAPNLGYDAD
17 -> 325 LVLDGGMGTMIQSYRLNEADFRGERFADWPCDLKGNNDLLVLSKPEVIAAIHNAYFEAGADIIETNTFNSTTIAMADYQMESLSAEINFAAAKLARACADEWTARTPEKPRYVAGVLGPTNRTASISPDVNDPAFRNITFDGLVAAYRESTKALVEGGADLILIETVFDTLNAKAAVFAVKTEFEALGVELPIMISGTITDASGRTLSGQTTEAFYNSLRHAEALTFGLNCALGPDELRQYVQELSRIAECYVTAHPNAGLPNAFGEYDLDADTMAKQIREWAQAGFLNIVGGCCGTTPQHIAAMSRAV
748 -> 840 KMVIATVKGDVHDIGKNIVGVVLQCNNYEIVDLGVMVPAEKILRTAKEVNADLIGLSGLITPSLDEMVNVAKEMERQGFTIPLLIGGATTSKA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.9 - methionine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0008168 - methyltransferase activity
GO:0008276 - protein methyltransferase activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0008705 - methionine synthase activity
GO:0031419 - cobalamin binding
biological_process GO:0044237 - cellular metabolic process
GO:0006479 - protein methylation
GO:0008652 - cellular amino acid biosynthetic process
GO:0009086 - methionine biosynthetic process
GO:0042558 - pteridine-containing compound metabolic process
GO:0032259 - methylation
GO:0035999 - tetrahydrofolate interconversion
GO:0050667 - homocysteine metabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
HOMOCYSMETB12-MONOMER
ECOLIWIKI:
b4019
INTERPRO:
IPR036594
INTERPRO:
IPR003759
INTERPRO:
IPR003726
INTERPRO:
IPR036589
INTERPRO:
IPR000489
INTERPRO:
IPR037010
INTERPRO:
IPR036724
INTERPRO:
IPR004223
INTERPRO:
IPR006158
INTERPRO:
IPR011005
INTERPRO:
IPR011822
INTERPRO:
IPR033706
MODBASE:
P13009
PANTHER:
PTHR21091:SF9
PDB:
6BM5
PDB:
6BM6
PDB:
3IV9
PDB:
3IVA
PDB:
6BDY
PDB:
1BMT
PDB:
1K7Y
PDB:
3BUL
PDB:
1MSK
PDB:
1K98
PFAM:
PF02965
PFAM:
PF02607
PFAM:
PF02574
PFAM:
PF02310
PFAM:
PF00809
PRIDE:
P13009
PROSITE:
PS50970
PROSITE:
PS51337
PROSITE:
PS51332
PROSITE:
PS50974
PROSITE:
PS50972
PROTEINMODELPORTAL:
P13009
REFSEQ:
NP_418443
SMART:
SM01018
SMR:
P13009
UNIPROT:
P13009


Operon      
Name: metH         
Operon arrangement:
Transcription unit        Promoter
metH
metH


Transcriptional Regulation      
Display Regulation             
Activated by: MetR
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4839 4223784 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4841 4227610 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4842 4227613 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4843 4227615 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB