RegulonDB RegulonDB 10.9: Gene Form
   

metK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

galP metK yqgD yqgC GalS GalR NagC CRP GalS GalR GalS GalR GalS GalR GalS GalR GalS GalR MetJ MetJ CRP terminator anti-terminator anti-anti-terminator yggIp3 yggIp3 yggIp6 yggIp6 galPp galPp TSS_3268 TSS_3268 TSS_3267 (cluster) TSS_3267 (cluster) TSS_3266 TSS_3266 metKp metKp

Gene      
Name: metK    Texpresso search in the literature
Synonym(s): ECK2937, EG10589, b2942, metX
Genome position(nucleotides): 3086706 --> 3087860 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.25
External database links:  
ASAP:
ABE-0009650
CGSC:
507
ECHOBASE:
EB0584
ECOLIHUB:
metK
OU-MICROARRAY:
b2942
STRING:
511145.b2942
COLOMBOS: metK


Shine dalgarno      
Sequence: attctctttaGGTGATattaaatATG


Product      
Name: methionine adenosyltransferase
Synonym(s): MetK, MetX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.952
Isoelectric point: 4.889
Motif(s):
 
Type Positions Sequence
50 -> 61 MVLVGGEITTSA
90 -> 90 C
159 -> 161 PWL
233 -> 370 IGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEK
337 -> 337 R

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.20 - S-adenosyl methionine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004478 - methionine adenosyltransferase activity
GO:0000287 - magnesium ion binding
GO:0030955 - potassium ion binding
GO:0042802 - identical protein binding
biological_process GO:0006556 - S-adenosylmethionine biosynthetic process
GO:0006730 - one-carbon metabolic process
GO:0033353 - S-adenosylmethionine cycle
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35672N
ECOCYC:
S-ADENMETSYN-MONOMER
ECOLIWIKI:
b2942
INTERPRO:
IPR022636
INTERPRO:
IPR022631
INTERPRO:
IPR022629
INTERPRO:
IPR022630
INTERPRO:
IPR002133
INTERPRO:
IPR022628
MINT:
P0A817
PANTHER:
PTHR11964
PDB:
1MXB
PDB:
1XRC
PDB:
1XRB
PDB:
1XRA
PDB:
1RG9
PDB:
1FUG
PDB:
1MXA
PDB:
1MXC
PDB:
1P7L
PFAM:
PF02773
PFAM:
PF02772
PFAM:
PF00438
PRIDE:
P0A817
PRODB:
PRO_000023216
PROSITE:
PS00376
PROSITE:
PS00377
REFSEQ:
NP_417417
SMR:
P0A817
UNIPROT:
P0A817


Operon      
Name: metK         
Operon arrangement:
Transcription unit        Promoter
metK
metK


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP, MetJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3266 3086683 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3267 (cluster) 3087216 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3268 3087246 forward nd [RS-EPT-CBR] [1]
  promoter yggIp6 3089588 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yggIp3 3089659 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB