RegulonDB RegulonDB 10.9: Gene Form
   

metL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

metL metB metF MetJ MetJ MetJ MetJ MetJ MetJ MetJ terminator anti-terminator anti-anti-terminator metFp metFp TSS_4644 TSS_4644 TSS_4643 TSS_4643

Gene      
Name: metL    Texpresso search in the literature
Synonym(s): ECK3932, EG10590, b3940, metM
Genome position(nucleotides): 4129835 --> 4132267 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.32
External database links:  
ASAP:
ABE-0012889
CGSC:
506
ECHOBASE:
EB0585
ECOLIHUB:
metL
OU-MICROARRAY:
b3940
STRING:
511145.b3940
COLOMBOS: metL


Shine dalgarno      
Sequence: ggctgcaaacAAGGGGtaaaaATG


Product      
Name: fused aspartate kinase/homoserine dehydrogenase 2
Synonym(s): MetL, MetM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 88.888
Isoelectric point: 5.27
Motif(s):
 
Type Positions Sequence
12 -> 284 RQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLINWLKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDAVYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRAERAAQPQVDEGLSYPLLQQLLVQHPGKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQ
253 -> 463 RLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIERVLASGTGARIVTSHDDVCLIEFQVPASQDFKLAHKEIDQILKRAQVRPLAVGVHNDRQLLQFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPVEFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVL
2 -> 252 SVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLINWLKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDAVYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRAERAAQPQVDEGLSYPLLQQLLVQHPGKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADPRKVKDACLLPLL
608 -> 803 PINHTVRDLIDSGDTILSISGIFSGTLSWLFLQFDGSVPFTELVDQAWQQGLTEPDPRDDLSGKDVMRKLVILAREAGYNIEPDQVRVESLVPAHCEGGSIDHFFENGDELNEQMVQRLEAAREMGLVLRYVARFDANGKARVGVEAVREDHPLASLLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAGAIQSDI
56 -> 56 Q

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.21 - homoserine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.7 - lysine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016491 - oxidoreductase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004072 - aspartate kinase activity
GO:0004412 - homoserine dehydrogenase activity
GO:0050661 - NADP binding
biological_process GO:0008152 - metabolic process
GO:0006520 - cellular amino acid metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009067 - aspartate family amino acid biosynthetic process
GO:0009086 - methionine biosynthetic process
GO:0009088 - threonine biosynthetic process
GO:0009089 - lysine biosynthetic process via diaminopimelate
GO:0009090 - homoserine biosynthetic process
GO:0016310 - phosphorylation
GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-10197N
ECOCYC:
ASPKINIIHOMOSERDEHYDROGII-MONOMER
ECOLIWIKI:
b3940
INTERPRO:
IPR041743
INTERPRO:
IPR005106
INTERPRO:
IPR011147
INTERPRO:
IPR018042
INTERPRO:
IPR019811
INTERPRO:
IPR036291
INTERPRO:
IPR036393
INTERPRO:
IPR001341
INTERPRO:
IPR001048
INTERPRO:
IPR042199
INTERPRO:
IPR001342
MODBASE:
P00562
PFAM:
PF00696
PFAM:
PF03447
PFAM:
PF00742
PRIDE:
P00562
PRODB:
PRO_000023217
PROSITE:
PS00324
PROSITE:
PS01042
REFSEQ:
NP_418375
SMR:
P00562
SWISSMODEL:
P00562
UNIPROT:
P00562


Operon      
Name: metBL         
Operon arrangement:
Transcription unit        Promoter
metBL


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP, HypT
Repressed by: MetJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4643 4129260 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4644 4129519 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB